SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5N4I1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5N4I1
Domain Number 1 Region: 423-653
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.98e-26
Family RecA protein-like (ATPase-domain) 0.007
Further Details:      
 
Domain Number 2 Region: 265-364
Classification Level Classification E-value
Superfamily DNA primase core 0.0000107
Family Primase fragment of primase-helicase protein 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5N4I1
Sequence length 699
Comment (tr|W5N4I1|W5N4I1_LEPOC) Progressive external ophthalmoplegia 1 {ECO:0000313|Ensembl:ENSLOCP00000015540} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MLRSGLFMKRAYSVLRVAVFHHRTLRHFSAPFLSLGGPRPPSLLQAQPRTPGLLLSCRTF
KKVLKTPSDLPASPVSVTDIKQYLRSKNIPFHDGYSCLHARSLFREPEGGAEGPERDSFS
MFIDKTTGQFLCKETQVEGSWEDLQDCVEVLQKERCSSLTPEVLLGYRESEEEQGEREAD
HREVLRIWASSVPLSELPDEETQLVRAMFGMGKISNATLKKFGVRFFKPTKGLVFPWFSA
WDSSLRGLKLLSAQRGGNDKVVYSEVTFPRPGAYRNLFGLHLVGRKDAEVVLTSQEVDTL
AVTQATGLPSVALPRGTSCLPPALLPYLEQFKKVFLWLGGDMRSWEASKIFSRKLGLKRC
SLVRPGEAQPCPSEALAQGKNLARILKAAIPAAHKSIVSFRQLREDVYGELANKDQVAGV
KWTRFPELNKILKGHRKGELSVFTGPTGSGKTTFISECALDLCMQGVSTLWGSFEINNVR
LAKIMLTQFSMQRLEDSLEQYDSWADKFEDLPLYFMTFHGQQSIKPVLDTMHHAVYLYDI
SHVVIDNLQFMMGQESLSVDKFALQDHIIGAFRKFATQNSCHVTLIIHPRKEEDDKELQT
ASIFGTAKASQEADNVLILQEKKLVSSPGRRSLQVAKNRFDGDVGIFPLEFDKASLTFSS
PKSKAWLRKVKSNKANEPEAREKGPAKSTGPGGAGNKKQ
Download sequence
Identical sequences W5N4I1
XP_006630966.1.81211 XP_015203154.1.81211 ENSLOCP00000015540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]