SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5N7N5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5N7N5
Domain Number 1 Region: 532-900
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.88e-128
Family Hect, E3 ligase catalytic domain 0.00000000441
Further Details:      
 
Domain Number 2 Region: 19-155
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.23e-29
Family Synaptotagmin-like (S variant) 0.053
Further Details:      
 
Domain Number 3 Region: 476-515
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000196
Family WW domain 0.00024
Further Details:      
 
Domain Number 4 Region: 348-388
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000862
Family WW domain 0.0015
Further Details:      
 
Domain Number 5 Region: 184-222
Classification Level Classification E-value
Superfamily WW domain 0.000000000000196
Family WW domain 0.0012
Further Details:      
 
Domain Number 6 Region: 428-465
Classification Level Classification E-value
Superfamily WW domain 0.00000000000223
Family WW domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5N7N5
Sequence length 907
Comment (tr|W5N7N5|W5N7N5_LEPOC) E3 ubiquitin-protein ligase {ECO:0000256|PIRNR:PIRNR001569} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MASVAEVRGLQTDEEDSRILRVKVIAGIGLAKKDILGASDPYTRVSLYDPVNGELTSVQT
KTIKKTLHPKWNEEFFFRVHPRKHRLLFEVFDENRLTRDDFLGQVDVPLHQIPMENPNIE
RPFTFKDFLLHPRSHKSRVKGHLRLKMTYLPKSNGSEEDNAEQTEELDPGWEFLDQQDMA
GTCQQQLPALPPGWEERQDNLGRTYYVNHDTRTTQWHRPTIQDSQAEEEQRQTIHLEAQH
AFTARRQISDHVEGHDRRDSPDSWEIITEDEATIYNNHNQRSPPPPLSPMEQPLCDVQSH
LADELGRSLQTSAQVAGDRRMSLPHQSHSSRRGSSQTPTLEEQPTQPVFMPTSAGLPPGW
EEKQDSKGRTYYVNHNSRTTTWTRPVIQTTTEAVQATSCTSPTVCQPPLLSPETSPQHAS
SQKPLYETGFLPAGWEIRSAPNGRPFFIDHNTKTTTWEDPRLKIPVQMRRRLSLDPADLG
PLPPGWEERVHTDGRIFYIDHNTKATQWEDPRLLNSAITGPAVPYSRDYKQKYEYFRKKL
KKPADIPNRFEMKLRRAAVLEDSYRRILSVKRADFLKARLWIEFENEKGLDYGGVAREWF
FLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLD
AFFIRPFYKMMLQKPITLQDMESVDSEYFNSLKWILENDPTDLDLRFTIDEELFGQTHQH
ELKPGGTDIVVTNKNKKEYIHLVMQWRFVNRVQKQMSAFKEGFYELIPLDLIKIFDENEL
ELLMCGLGDVDVNDWRENTKYKNGYCATQPVIQWFWKTVLLMDAEKRIRLLQFVTGTSRL
PMNGFAELYGSNGPQLFTIEQWGTPDKLPRAHTCFNRLDLPPYESFEELREKLHLAIENA
QGFDGVD
Download sequence
Identical sequences W5N7N5
XP_015198834.1.81211 ENSLOCP00000016644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]