SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5N8I4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5N8I4
Domain Number 1 Region: 282-466
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.65e-47
Family Nucleotide and nucleoside kinases 0.00000253
Further Details:      
 
Domain Number 2 Region: 140-272
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-33
Family SH3-domain 0.00082
Further Details:      
 
Domain Number 3 Region: 71-156
Classification Level Classification E-value
Superfamily PDZ domain-like 1.26e-19
Family PDZ domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5N8I4
Sequence length 470
Comment (tr|W5N8I4|W5N8I4_LEPOC) Membrane protein, palmitoylated 1 {ECO:0000313|Ensembl:ENSLOCP00000016943} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MTLKSNKNEPAAVFERVNSVRTALSDLYLEQLLQNKPKPEKAVMQTEKATGKEVYTNGSA
DSSLMNGKEINKMRLVQFEKNPAQPLGVTLKLNEKQRCTVARILHGGMIHRQGSLHEGDE
IAEINGKSVAYQSVDQLQKMLKDTNGIVTLKIIPNQQSRSLAFEMYVRAQFDYDPAKDDL
IPCKEAGLKFKRGDIIQIINKQDPNWWQGRVESSDVDFAGLIPSLDLQEWRVASRSTSGA
EGNQSCSPFGKKKKCKDKYLAKHSSVFDQLDVISYEEVVKLPAFNRKTLVLIGAPGVGRS
HIKSTLLTKNPEKFAYPPPHTTRPQKKDEENGKDYYFISNEVMTKCITNNELLEYGSFQG
HMFGTKFETINKIHEQGKIAVLDIEPQTLKLLRTADFAPLVVFIAPTTAASQSESLQQIQ
KESDAIFSTYGHYFDVTLVNNDVDESVKGVEAAIERASSTPQWVPVSWVY
Download sequence
Identical sequences W5N8I4
XP_006632677.1.81211 ENSLOCP00000016943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]