SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5NC83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W5NC83
Domain Number - Region: 276-306
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0654
Family Ypt/Rab-GAP domain of gyp1p 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5NC83
Sequence length 322
Comment (tr|W5NC83|W5NC83_LEPOC) Uncharacterized protein {ECO:0000313|Ensembl:ENSLOCP00000018242} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MGNTTTREDFEWVYTEQPHSTRRREILAKHPEIKSLMGPDPYLKWIVTAMVLTQLLACYL
VRDLSWKWLFFWAYAFGGCVNHSLTLAIHDISHNAAFGNKEARWNRLFGMFANLPIGLPY
SVSFKKYHIDHHRYLGGDRLDVDIPTALEARLFSTPLRKVVWLVLQPFFYALRPLCVNPK
PVSQLELLNGLVQLAYDLALYQLWGMKPVVYMVAGSLLCLGLHPISGHFIAEHYMYLKGH
ETYSYYGPLNWLTFNVGYHMEHHDFPSIPGCRLPQVKKMAPEFYDHLPQHDSWIRVLWDF
VFCDQLGPFSRIKRECRLVKED
Download sequence
Identical sequences W5NC83
ENSLOCP00000018242 XP_006627679.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]