SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5NEZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W5NEZ3
Domain Number - Region: 159-199
Classification Level Classification E-value
Superfamily RUN domain-like 0.0615
Family RUN domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5NEZ3
Sequence length 247
Comment (tr|W5NEZ3|W5NEZ3_LEPOC) Uncharacterized protein {ECO:0000313|Ensembl:ENSLOCP00000019202} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MQLVVLVMRVGLDRGFCGHAHLELKHLLLVLLHNLGDWRTQLPELCLTLADLSKHHHTLL
WLVQLLPDCRERWRQLRRHLSLAIMSKLLGMQKQPGPLPRHSQLAALCPLLVLMKPAVLQ
EQLRAQRRLAQLPPLSPDTLDLQAHYLCHSLLALAGIIVGAHNLPSKQWGDLQQLCYLLE
RYVLAGIREHGHFLYRSVVKDRAARLHVIWLRLLYTNMPPQLQYLNDQEQPEERSSDCKT
RPDVEIL
Download sequence
Identical sequences W5NEZ3
ENSLOCP00000019202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]