SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5NFI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5NFI4
Domain Number 1 Region: 246-346
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.25e-27
Family Ras-binding domain, RBD 0.0000041
Further Details:      
 
Domain Number 2 Region: 991-1091
Classification Level Classification E-value
Superfamily PDZ domain-like 6.97e-23
Family PDZ domain 0.0000337
Further Details:      
 
Domain Number 3 Region: 38-138
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.61e-23
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 4 Region: 400-498
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.31e-20
Family FHA domain 0.00000703
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5NFI4
Sequence length 1812
Comment (tr|W5NFI4|W5NFI4_LEPOC) Afadin, adherens junction formation factor {ECO:0000313|Ensembl:ENSLOCP00000019393} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN=AFDN OC=Lepisosteus.
Sequence
MSGSREEERRKLADIINHWNANRLDLFEISQPTEDLEFHGVMRFYFQDRVAGNFATKCIR
VSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERKLDLDEKPLVVQLNWNKD
DREGRFVLKNENDIAPKKTQSNGPEKQEKEGVIQNFKRTLSKKEKKKEKKRDKEAFPRIV
DGDERSLNREDGENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSD
GRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAEALEKYGLEKENPRDYCIARVV
LPPGSQQSDDKGGKETILDDTECPLQIFRDWPSDKGALVFQLKKRPPDYIPKKARKPEEK
VSRGRSVDVPLHSSLPPEKLPYLVELSPGRGNHYAYYNYRHQEDGSDSRDKPKLYRLQPS
ITEVGTEKMDDNSIQLFGPGILPYHCNLMHADGLVTVTPRSFEAETFVDGQRITETTVLR
SGMKVQFGASHVFKFVDPSYDHSLSKRSMDSGPMVKGPRSKSGSVPETTFDLHGEIHSGA
ALPPSKSSGKLDMEHSGPTSNLSERGMVKPMVRGEQQDNRSQDGLGPELTLPASIEFREN
SEDAFLSAIINYTNSSTVHFKLSPTYVLYMTCRYVLSSNYRPDMSPSERTHKVIAIVNKM
VSMMEGVIQEIAEGDQKQKNIAGALAFWMANASELLNFIKQDKDLSRITLDAQDVLAHLV
QMAFKYLVHCLQSDLSNYMPAFLDDPEEQNPQRPKIEDVLHTLTGAMSLLRRCRVNAALT
IQLFSQLFHFINMWLFNKLVTESDSGLCSHYWGAILRQQLSHIEAWAEKQGLELAADCHL
SRIVQATTLLTMDKYSMQDVPSIHNTCFKLNSLQLQALLQNYHCAPDEPYIPPELIDNVV
AVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVRNIPNGFQEFLEPLCQRG
FCRLIPHPRSPGTWTIYFEGADCDSHFSADNADLQMRKEPEVVTVTLKKHNGMGLSIVAA
KGAGQDKLGIYIKSVVKGGAADMDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTGSVV
TLEVAKQGAIYHGLATLLNQPSPMMQRASDRGRGSGKPRPKSEGFELYNNSAQNGSPESP
QGPWGEYHEPKKITGEERLLKNRADHRSSPNVASEYGPDQPQSPGGMPVYSGGPTAKITS
VSTGNLCTDDQPPPPRPEAYPIPTQTYTREYFTFPAPKSQDRMGPGPGQQWQSYEDGVPG
QHDDRHPGNMVIQRATRSQEELSDDRGLYYLERGRQEDLAHLQHREAEYQREHGSGEHWN
HQVSSSVESSTSSQEHLNYSSSSKNAPNHKSGPGRWKTPIAPHSAPVAVSQPIRTDLPPP
PPPPPPVQYATEFDSQAELPLPPPPAQQAADRKKREEQQRWYEKEKARLEEERDRKRREQ
ERKLGHMRNPPGPVPLANQQIGPMPPPPQHQQLPPPPAPIPMQQPQSYLPPQQQQPPRPE
KLSSIPRAPPPPQETVIRELLPQQQPRTIERRDLQYITISKEELSSSDSLSPDPWKRDAR
EKLEKQQQMHIVDLLDKEIQELQAKPERTAEENDRLRKLMLEWQFQKRLQESKQSEEDEE
EDDDEDVDTMMIMQRLEAEKRVRQTAVPAISVLDLLQDEERRRKQQLEEIRKREAEDRAK
QEEERRWREEERARREAEEKRRQEEEYYTRLEAERRRQHEEAERKLLTPDEPGYNSYTGN
ATGVVGSHEVYKDPREKWGKGGQEQDTSVGSEAPESLTFKERQRLFSQGQDVSNKVKASR
KLMELENELNTK
Download sequence
Identical sequences W5NFI4
ENSLOCP00000019393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]