SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5NG17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5NG17
Domain Number 1 Region: 14-298
Classification Level Classification E-value
Superfamily Terpenoid synthases 1.58e-76
Family Isoprenyl diphosphate synthases 0.000000000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5NG17
Sequence length 302
Comment (tr|W5NG17|W5NG17_LEPOC) Geranylgeranyl diphosphate synthase 1 {ECO:0000313|Ensembl:ENSLOCP00000019576} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
FQAMDGDKAAASERILLEPYRYLLQLPGKQVRTKLSQAFNHWLNVPDDKLQVIIEVTEML
HNASLLIDDIEDNSKLRRGFPVAHSIYGIPSVINSANYVYFLGLEKVLTLEHPEAVQVFT
RQLLELHRGQGLEIYWRDTYTCPTEQEYQQMVLQKTGGLFGLAVGLMQLFSSYQRDLKPL
LNTMGLFFQILDDYANLRSKVYSENKSFCEDLTEGKFSFPIIHAIWSHPESTQVQNILRQ
RTENVDIKRYCVDYMEKVGSFAYTRQTLQNLEAEAYRLIQDLGGNLELTALVEQLSKTYK
ET
Download sequence
Identical sequences W5NG17
ENSLOCP00000019576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]