SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5NG98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5NG98
Domain Number 1 Region: 437-567
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000173
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 629-671
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000439
Family EGF-type module 0.0024
Further Details:      
 
Domain Number 3 Region: 374-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000251
Family EGF-type module 0.007
Further Details:      
 
Domain Number 4 Region: 663-704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000044
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 5 Region: 339-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000507
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 6 Region: 747-857
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000942
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 7 Region: 299-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000234
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 707-745
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000937
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  W5NG98
Domain Number - Region: 593-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00024
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 871-899
Classification Level Classification E-value
Superfamily PMP inhibitors 0.000288
Family PMP inhibitors 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5NG98
Sequence length 1218
Comment (tr|W5NG98|W5NG98_LEPOC) Delta-like protein {ECO:0000256|RuleBase:RU280815} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MILKRSSFLAALSLHVVLFCLRAKVSLASGSFELQILSMQNVNGELQNGMCCDGTRNAAD
RKCMRDECDTYFKVCLKEYQSRVSAEGACSFGSGSTSVIGGNTFSLKNIKRNEKSRIVLP
FTFAWPRSYTLIVEALDFNNDTTNNNPGGELIEKAVHSGMINPNRQWQTLKHNGAAAQFE
YQIRVTCDEHYYGFGCNKFCRPRDEFFGHYTCDHNGNKTCLEGWSGPDCSKAICRQGCSS
EHGSCKLPGQCRCLYGWQGDICDKCIPHPGCVHGTCIEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNGGTCSNTGPDKYQCSCPEGYSGVNCERAERACLSDPCFNGGSCVETSSGFEC
QCAPGWSGPSCMTNVDDCATNPCNHGGTCQDLVNGFKCSCPPQWTGKTCLIDANECDGQP
CVNANSCRNLIGGYFCECIPGWTGQNCDINVNDCKGQCQNGETVKDLVNGYRCVCPAGYA
GEHCERDINECASSPCLNGGRCQDEVNGFQCLCLAGYSGNLCQLDIDYCEPNPCQNGAQC
YNLATDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAVASNSTPEGVRYISSNVCG
PHGRCKSQAGGKFTCECKEGFTGTYCHENINDCESNPCRNGGTCIDKVSIYQCICSDGWE
GVHCETNINDCRTNPCHNGGTCRDLVNDFYCECKNGWKGKTCHSRESQCDEATCNNGGTC
YDEGDTFKCMCSLGWEGATCNIAKNSSCLPNPCENGGTCVVSGDSFTCVCKEGWEGSTCT
QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
GYQCLCPPDRSGPRCQEVIRRPCIASGRVMYDGTKWVEDCNTCRCQNGRVSCTKMWCGPK
PCRVHAKGRTECSAGQTCVPVKADHCFVPPCAEQGQCWPSGQEPAKPKCHSSSQFLDNSC
INIIFTFNKEKMEPGLTTERICVELRKLYVMKNLSSEFSVYMTCEPSLSANNEIHVSVST
DDLRKDKSPIKEITNRITDLDSKREGNNTIINAIGEVRIQDKDNKQDYLVPLLSSIFIVL
WILALVTAFLWCVRRRRKQSSHTHTAQEDNTTNNVREQLNQIKNPIEKHAAGTIPIKDYE
SKNSIIAKIRTHNSEMEEDDTDKHLQKARFAKQPAYTLVDREDRSPHTTPTKNPNWTNKQ
DNRDLETAQSLNRMEYIV
Download sequence
Identical sequences W5NG98
ENSLOCP00000019657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]