SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5NHL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5NHL7
Domain Number 1 Region: 100-194
Classification Level Classification E-value
Superfamily PDZ domain-like 9.33e-30
Family PDZ domain 0.013
Further Details:      
 
Domain Number 2 Region: 24-77
Classification Level Classification E-value
Superfamily L27 domain 1.33e-19
Family L27 domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5NHL7
Sequence length 228
Comment (tr|W5NHL7|W5NHL7_LEPOC) Protein lin-7 homolog {ECO:0000256|PIRNR:PIRNR038039} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
LLNVQTSSKTLEATLDVLYYSSVHLDVARAIELLEKLQESGDLPVSKLQSLKKVLQSEFC
TAIREVYQYMHETITVNGCPEYQARATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNV
MGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDTV
KLVVRYTPKVLEEMEARFEKLRTARRKGNEQLIELELEQLHQHQRGEQ
Download sequence
Identical sequences W5NHL7
ENSLOCP00000020126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]