SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5NR90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5NR90
Domain Number 1 Region: 132-188
Classification Level Classification E-value
Superfamily F-box domain 0.00000343
Family F-box domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5NR90
Sequence length 376
Comment (tr|W5NR90|W5NR90_SHEEP) Transmembrane protein 183A {ECO:0000313|Ensembl:ENSOARP00000000680} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=TMEM183A OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MARGPGPLTRPRPDTVAMPKRGKRLKFRAQDACSGRVTVADYANSDPAVVRSGRVKKAVA
NAVQQEVKSLCGLEASQVPAVEALSGAGEPCDIIDSSGETDAQEESIHERTISRKKKSKR
HREDLNGTGGEEYPMDIWLLLASYIRPEDIVNFSLICKNAWTVTCTAAFWTRLYRRHYTL
DASLPLRLRPESMEKLHCLRACVIRSLYHMYEPFAARISKNPAIPESTPSTLKNSKCLLF
WCRKIVGNRQEPMWEFNFKFKKQSPRLKSKCMGGLQPPIQYEDVHTNPDQDCCLLQVTTL
NFIFIPIVMGMIFTLFTISVSTDMRHHRVRLVFQDYPVHGGQKLRSEQGVQVILDPVHSV
RLFDWWHPQYPSSLRA
Download sequence
Identical sequences W5NR90
ENSOARP00000000680 XP_004013586.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]