SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5NS48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5NS48
Domain Number 1 Region: 142-203
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.31e-21
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 2 Region: 83-141
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000012
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 3 Region: 27-78
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000135
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Weak hits

Sequence:  W5NS48
Domain Number - Region: 2-22
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0459
Family Complement control module/SCR domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5NS48
Sequence length 204
Comment (tr|W5NS48|W5NS48_SHEEP) Uncharacterized protein {ECO:0000313|Ensembl:ENSOARP00000000988} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN= OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MTCTESGWSPPPRCIRVKTCSKSEIRIENGFLSESAFMYPLNKQTEYKCKPGYVTADGKT
SGLITCLQDGWSAQPVCINSKGKCGPPPPIDNGDITSLLQSVYPPGYTAEYQCQLYYELR
GNRNIVCQNGEWSEPPKCLEACVISEETMKKHHIQLRWKHDTKLYYKTEDTIEFTCEYGY
HQLTPKHTFRTTCQEGKVVYPRCG
Download sequence
Identical sequences W5NS48
ENSOARP00000000988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]