SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5NSJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5NSJ2
Domain Number 1 Region: 68-251
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.23e-75
Family F-box associated region, FBA 0.00000187
Further Details:      
 
Domain Number 2 Region: 4-83
Classification Level Classification E-value
Superfamily F-box domain 1.27e-16
Family F-box domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5NSJ2
Sequence length 255
Comment (tr|W5NSJ2|W5NSJ2_SHEEP) F-box protein 44 {ECO:0000313|Ensembl:ENSOARP00000001132} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=FBXO44 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MAVGNINELPENILLELFTHVPARQLLLRCRLVCSLWRDLIDLVTLWKRKCLREGFITED
WDQPVADWKVFYFLRSLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSKDQRKEFPND
QVKKYFVTSYYTCLKSQVVDLKAEGYWEELMDTTRPDIEVKDWFAARPDCGSKYQLCVQL
LSSAHAPLGTFQPDPAMIQQKSDAKWREVSHTFSNYPPGVRYIWFQHGGVDTHYWAGWYG
PRVTNSSITIGPPLP
Download sequence
Identical sequences W5NSJ2
ENSOARP00000001132 XP_004013770.1.66739 XP_011966699.1.54773 XP_011966700.1.54773 XP_011966701.1.54773 XP_012042718.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]