SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5NVP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5NVP4
Domain Number 1 Region: 340-389
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000353
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 248-297
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000051
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Weak hits

Sequence:  W5NVP4
Domain Number - Region: 963-1098
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00229
Family Rhodopsin-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5NVP4
Sequence length 1493
Comment (tr|W5NVP4|W5NVP4_SHEEP) Adhesion G protein-coupled receptor B1 {ECO:0000313|Ensembl:ENSOARP00000002240} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=ADGRB1 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
ARGQGPHWRLGARVGTALSVPSPGAQPCPLLFLFQLLLETMXFSAAAVFPANASRCSWTL
RNPDPRRYTLYMKVAKAPACSGPARVRTYQFDSFLESTRTYLGVESFDEVLRLCDPSAPL
AFLQASKQFLQMQRLRPPQDNTLGARDGPPGPSDDFSVEYLVVGNRNPSRAACQMLCRWL
DACLAGSRSSHPCGIMQTPCACLGGDTGDPASGSLAPRGDVCLRDGVAGGPENCLTSLTQ
DRGEDGAPGGWKLWSLWGECTRDCGGGLQTRTRTCLPAPGIEGGGCEGVLEEGRLCNRKA
CGPAGRTNSRSQSLRSTDARRREELGDDLQQFGFPAPQTGDPAAEEWSPWSVCSSTCGEG
WQTRTRFCVSSSYSTQCSGPLREQRLCNNSVVWKETPAGEVAAVRCPRNATGEGQGGRGW
QGTCPSLAGCAGGTKMPRRPAQELSAQGTWPRPRPGSPMRTKTRGVRAGTQGCHVLSHWS
ECQHEHANLWSDTSVLQIQESKVKTQVAGWCDFSSLCLLCPGSSLGSSRLCLAPWNQPQG
CPVSTAHQGHEGPPDPRGGAGQRHLGAVAGSGRWSQPPISTGLILRRCELDEEGIAYWEP
PTYIRCVSIDYRNIQMMTREHLAKAQRGLPGEGVSEVIQTLVEISQDGTSYSGDLLSTID
VLRNMTEIFRRAYYSPTPGDVQNFVQIISNLLAEENRDKWEEAQLMGPNAKELFRLVEDF
VDVIGFRMKDLRDAYQVTDNLALSIHKLPASGATDISFPMKGWRATGDWAKVPEDRVTVS
KSVFSTGLAEADDSSVFVVGTVLYRNLGSFLALQRSPSVITLQPVGQGCLPSPVCAPWWP
DFHHLFQGTTNQTCILWDETDPLAPPPPTPPPSPWFPWRGRDTVPTPCSLTRVICAHSGF
LLLRGRTPMSHSHSSLSVPALSLVRSCGYRDLLFQRRTLPWLSLWRAPKMYIRSERSVIL
INFCLSIISSNALILIGQTQTRNKAVCTLVAAFLHFFFLSSFCWVLTEAWQSYMAVTGRL
RNRLVRKRFLCLGWGLPALVVAISVGFTKARGYSTMNYCWLSLEGGLLYAFVGPAAAVVL
VNMVIGILVFNKLVSKDGITDKKLKERAGASLWSSCVVLPLLALTWMSAVLAVTDRRSAL
FQILFAVFDSLEGFVIVMVHCILRREVQDAVKCRVVDRQEEGNGDSGGSFQNGHAQLMVG
FGAGTQTAPARPQQPDRRTSEPSLRLGSRRGETRSPGAWPGSRDEGAGRGRCLPRAHPLV
PATPSVRTPSAPLPPLPVQTLVTSWVNSPRCHLVPAARWVPPAGRALAEASGRAQXPSLA
RSSPSACPHPQPSVPPPFSSHVPTSLKAAQQRGQCAVPPAGGLCATPPGSTGCPXGGSQP
QGAQAWKARRPASPLWEWAPLAGWEPEAWAGASLPPPGPPGVCQGPAWGGDLRVCSPVYT
NPFSPQRRKSRYAELDFEKIMHTRKRHQDMFQDLNRKLQHTEKDKDVLGPDSK
Download sequence
Identical sequences W5NVP4
ENSOARP00000002240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]