SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5NW55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5NW55
Domain Number 1 Region: 116-178
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000057
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 263-322
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000057
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 3 Region: 78-126
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000306
Family Complement control module/SCR domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5NW55
Sequence length 465
Comment (tr|W5NW55|W5NW55_SHEEP) Sushi repeat containing protein, X-linked 2 {ECO:0000313|Ensembl:ENSOARP00000002402} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=SRPX2 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MAIQLTRRGALSLLLFLTPAVMPTWYAGSGYHPDESYNEVYAEEVPQTRILDYQVPRWCY
TLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQM
RCHALPFITSGTYTCTNGVLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDID
PPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRLILRGPEPGSHFPEGEHVIR
YTAYDRAYNRASCKFIVKVQVRRCPTLKPPLHGYLTCTSVGDNYGATCEYHCDGGYERQG
TPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKRRLLIISAPDPSNRYYKMQ
ISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSANIIEELRQFQHLTRSYFNMVL
IDKQGIDRERYMEPVTPEEIFTFIDDYLLSNEELIQRREQRDMCD
Download sequence
Identical sequences W5NW55
ENSOARP00000002402 XP_004022551.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]