SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5NX24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5NX24
Domain Number 1 Region: 271-363
Classification Level Classification E-value
Superfamily Immunoglobulin 5.38e-19
Family I set domains 0.051
Further Details:      
 
Domain Number 2 Region: 122-175
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000746
Family TSP-1 type 1 repeat 0.00085
Further Details:      
 
Domain Number 3 Region: 189-246
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000235
Family Carboxypeptidase regulatory domain 0.077
Further Details:      
 
Weak hits

Sequence:  W5NX24
Domain Number - Region: 453-515
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00173
Family Carboxypeptidase regulatory domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5NX24
Sequence length 587
Comment (tr|W5NX24|W5NX24_SHEEP) Uncharacterized protein {ECO:0000313|Ensembl:ENSOARP00000002721} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=LOC101107342 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
GTPDAEEPTVTAWGLEGSSLRPGQPSPALEDWEEASEWTSWFNVDHPGGDGDFESLAAIR
FYYGPARVCPRPLALEARTTDWALPSDVGERVHLNPTRVFWCLNREQPRGRSCSNYHVRF
RCPLEATWGSWGPWGPCSGSCGPGRRLRRRRCPSPAGDACPGRPSEAQKCVRPRCPGCGP
NTCGCPDHILLGSVVTPSGHPLPGARVSLRDWPGTVATSDAHGTFRMPGVCASSRANVSA
QMDGFSAGMAQAQANSSMSAVATVVLNKLEKPYLVKHPESRVREAGQNVTFCCKASGTPM
PKKYSWFHNGTLLDRRTHRYGAHLELHGLRPDQAGTYHCKAWNDAGAVRSGTARLTVLAP
GQPACDPRPQEHLIKLPDDCGQPGRGPTYLDVGLCPDTLCPSPAGSSPRCGDAGSRCCSV
SRLESRKVHCSGYTLPVKIVAECGCQKCLPLRGLIRGRVVAADSSEPLRFARILLGREPI
GFTSYQGDFTLEVAPSTQRLVMTFVDPSGQFVDTVRVLPFDPRGAGVYHEVKAMRKKAPI
ILDARQSNTISLGEMGEEAPLAAGIIPPGAFRSADGQPYTGAVEAQV
Download sequence
Identical sequences W5NX24
ENSOARP00000002721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]