SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5P3U1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5P3U1
Domain Number 1 Region: 22-108
Classification Level Classification E-value
Superfamily F-box domain 0.00000000262
Family F-box domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5P3U1
Sequence length 459
Comment (tr|W5P3U1|W5P3U1_SHEEP) F-box protein 15 {ECO:0000313|Ensembl:ENSOARP00000005093} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=FBXO15 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MLPSGPAALSRHARQDKVCRRPSAGCSASLDSLPSEVLLKILSYLDAAALLCAGCLANDN
FIWIRLYSAAFSPKRSHWRVDPAEKMDLSVNLLSAGDKEAGYWKKEYLTKQIASVKAALA
QVLKPLHPNTGLPVKTKEALRVSGLGWVIILRGADGREYTMEHADLSVNDSSVTVAWYGK
DWPPLATLSTLDLCGVTPVFMGKSRAPSRTRPRWHSLITKYQLSQLTESSAVGGDRLMRV
FCLPPGLVVGLWKREEELAFVMANLHLHRLMERSMLGSPAVPYELPPHTPVSDDSPERGL
HGYRLHVDMHSGGVSCLCGSFRNLSASKGYLENEYMKLSVISFKNNTEHLPLIGKVGLSW
KTNSFDGCIKSCSIMDLTLLEEYGQPFWCFSSPVCVRCCPGPSDGPNFLGEAYYVDYSDS
EGRLRMELVWIEETEEYFIVSLALYLRLAKVNQWFGTEY
Download sequence
Identical sequences W5P3U1
ENSOARP00000005093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]