SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5P7B7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5P7B7
Domain Number 1 Region: 228-347,411-484
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.66e-17
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 2 Region: 6-135
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.45e-16
Family Clostridium neurotoxins, the second last domain 0.042
Further Details:      
 
Domain Number 3 Region: 1277-1344
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000278
Family Complement control module/SCR domain 0.0058
Further Details:      
 
Domain Number 4 Region: 1208-1280
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000347
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 5 Region: 1146-1216
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000104
Family Complement control module/SCR domain 0.0035
Further Details:      
 
Domain Number 6 Region: 371-436,547-561
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000000367
Family Reprolysin-like 0.076
Further Details:      
 
Domain Number 7 Region: 1076-1150
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000556
Family Complement control module/SCR domain 0.0044
Further Details:      
 
Weak hits

Sequence:  W5P7B7
Domain Number - Region: 539-569,748-801
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00013
Family Fibronectin type III 0.0075
Further Details:      
 
Domain Number - Region: 1416-1445
Classification Level Classification E-value
Superfamily Notch domain 0.0418
Family Notch domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5P7B7
Sequence length 1489
Comment (tr|W5P7B7|W5P7B7_SHEEP) Pappalysin 1 {ECO:0000313|Ensembl:ENSOARP00000006321} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=PAPPA OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
GLYDKCSYASRDRGWVVGIHTVSDQGNRDPRYFFSLKTDRARQVTTINAHRSYLPGQWVY
LAATYDGRLMKLYMNGAQVATSGEQVGGIFSPLTQKCKVLMLGGSALNHNYRGYVERFSL
WKVARTQREILLDMGTRSPQGPLPQLLLQENWDNVKRAWSPMKDGSSPRVEVSGAHGSLL
DTSLEPPLCGQTLCDSPEVIANYNRLPRLRQPKVVRYRVVNLHDDGRENPTVSRQQIDFQ
HQQLAEAFKHYNISWELEVLEVSNSSLRRRLILANCDISKIGDENCDPECNHTLTGHDGG
DCRHLRHPAFAKKQQNGVCDMDCNYERFNFDGGECCDPNITDVTKTCFEPDNLHRAYVDV
NEMKNILRLDGSTHLNIFFANSSEEELAGVATWPWDKEALMHLGGIVLNPSFYGIPGHTH
TMIHEIGHSLGLYHIFRGISEIQSCSDPCMETEPSYETGDLCSDTNPAPKHKFCGDPGPG
NDTCGFNSFFNTPYNNFMSYADDDCTDSFTPNQVARMHCYLDLVYQGWQPSRKPAPIALA
PQVVGHTTGSVMLEWFPPIDGHVFERELGSACDLCLEGRFLVQYAFNASSPMPCGPSGHW
SPREAEGHPDVEQPCKSSVRTWSPNSAVNPHTVPPACPEPQGCHLDLRFRYPVVPESLTV
WVTFVSTDWDSSGAVNDIKLLGISGNNISLGPQNIFCDVPLTIKLQDVSEEVYGVQIYTL
DEHLEIDAAMLTSVADSPLCLECKLLQYKVVRDPPLQVDVASTLHFSRRFTDTDVRLGSR
YQYWVIAISGSEESEPSPAAIYIHGSGYCGDGVIQRSQGEECDDMNKINGDGCSLFCRQE
ASFNCIDEPSRCYFHDGDGVCEEFEQKTSIKDCGVYTPQGFLDQWASNATVSHQDQQCPG
WVIIGQPAASQVCRTKVIDLSEGISQHAWYPCTISYPYSQLAQTTFWVRVYFSQPMVATA
VIVHLVTDGTYYGDQKQETISVQLLDTNEQIHDLGFHVLSCRNNPLIIPVVHDLSQPFYH
SQAVRVSFSSPLVAISGVALRSFDNFDPVTLSSCQRGETYSSAEQSCVHFACEAADCPTL
AVENASLNCSSSDGYHGAQCTVRCRTGYVLQIQRDDELIKSQAGPSVTVTCTEGKWNKQV
ACEPVDCGIPDQHHVYAASFSCLEGTTFGSKCSFQCRHPAQLKGNNSLLTCMEDGLWSFP
EALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCRPGYHVPGSSRKSKKRAFKTQ
CTQDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRINCEDSDATQGRGNNVIHC
RKDGTWSGSFHVCQEMQGECSAPDQLNSNLKLQCPEGYAIGSECTTSCLDHNSESIVLPV
NVTVRDIPHWLNPTRVQRVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNY
DGGDCCASTVKTKKVTPFPMSCDLQGDCACRDPQAQEHTRKDLRGYSHG
Download sequence
Identical sequences W5P7B7
ENSOARP00000006321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]