SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5P7X2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5P7X2
Domain Number 1 Region: 66-256
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.77e-52
Family Astacin 0.00014
Further Details:      
 
Domain Number 2 Region: 426-592
Classification Level Classification E-value
Superfamily TRAF domain-like 2.78e-33
Family MATH domain 0.0014
Further Details:      
 
Domain Number 3 Region: 264-427
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.22e-30
Family MAM domain 0.0013
Further Details:      
 
Weak hits

Sequence:  W5P7X2
Domain Number - Region: 605-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000401
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5P7X2
Sequence length 700
Comment (tr|W5P7X2|W5P7X2_SHEEP) Endopeptidase-2 {ECO:0000256|PIRNR:PIRNR001196} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=MEP1B OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MTSWDLPWFLCSAALLSVSGLPTPEIFDVDNGLDRDIFDINEDLGLDLFEGDIMLDEMQE
RNAIVGERYRWPHTIPYVLDDSLEMNARGVILKAFERYRLKSCIDFKPWSGEPSYISVFK
GNGCWSSVGKQFTGMQQLSIGEGCDKIATVQHEFLHALGFWHEQSRSDRNDYVSIIWNRI
ISGKERNFDFYDDQVIDSLNVPYDYSSVMHYSKTAFGNGSEPTIVTRVPDFMDVIGQRMD
FSDSDVLKLNQLYNCSSSLSFMESCDFELENVCGMIQSSADSADWQRLSQVSQGPESDHS
NMGRCRGSGFFMHFNCSSVNEGATAILESRILYPKRGFQCLQFFLYNSGSKDDQLNIYIR
EYSAAHPSRTVSLVEQIKDIPSGSWQLYHVTLNATSKFRVVFEGVRGAGASLGGLSIDDI
NLSETRCPHHVWHIRNFTQLIGSPDGSFYSPPFYSSKGYAFQIYLDLYSLPKIGMYFHLI
SGANDDQLEWPCPWQQVTMTILDQTPDIRQRMSNQQSLTTDPFLTIDNGNYFWDRPSKVG
AQVIFPNGTQFQRGRGRGFHNFMTQELLKSRDFIKGDDVYILLTMEDISHLNTQNDPLPT
LDVNDLCTSFRCENDGICILQNGKAECRCRSGDDWWYMGERCEKRGSTRDTIVIATSSTA
AVFALMLIVTLVSIYCTRKKYRKEPSSRTVNTIMENQYAL
Download sequence
Identical sequences W5P7X2
ENSOARP00000006526 XP_004020496.1.66739 XP_011994754.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]