SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5P843 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5P843
Domain Number 1 Region: 261-460
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.6e-47
Family Reprolysin-like 0.002
Further Details:      
 
Domain Number 2 Region: 552-602
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000118
Family TSP-1 type 1 repeat 0.00041
Further Details:      
 
Domain Number 3 Region: 911-968
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000523
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 4 Region: 848-906
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000772
Family TSP-1 type 1 repeat 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5P843
Sequence length 1214
Comment (tr|W5P843|W5P843_SHEEP) ADAM metallopeptidase with thrombospondin type 1 motif 14 {ECO:0000313|Ensembl:ENSOARP00000006598} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=ADAMTS14 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MAPLCARLSCLLLLHCALCAAAGSGTEELRFSRKLSDYGVTVPCSTDSQGRFLSHVVSGP
AAVSAGSMKGDGPPSPLSHSGRLRVARSPLRPEGVTLQPGRVGRSSLYFNVTVFGEELHL
HLRPNRRLVVPGASVEWQEDFQELFRQPLKRECVYTGGVTGMPGAAVAISNCDGLAGLIR
TDSTDYFIEPFERGRREMEAGGRKHVVYRREVVRQPRTEPLGDLHNEAFGLGDLPNLLGL
VGDRLGEAERKRRRHATPGSYSIEVLLAVDDSVVRFHGKEHVQNYVLTLMNIVDEIYHDE
SLGVHINIALVRLIMVGYRQSLSLIERGNPSRSLEQVCRWAHSQQRQDPGHAEHHDHVVF
LTRQDFGPSGYAPVTGMCHPLRSCALNHEDGFSSAFVVAHETGHVLGMEHDGQANGCADE
TSLGSVMAPLVQAAFHRFHWSRCSKLELSRYLPSYDCLLDDPFAPAWPQPPELPGIDYSM
DEQCRFDFGTGYHTCSACFEACKQLWCSHPDNPYFCKTKKGPPLDGTECAPGKWCFKGHC
IWKSPEQTYGQDGGWSSWTKFGSCSRSCGGGVRSRSRSCDNPPPAYGGRMCSGPMFQYQI
CNSEECPGPYEDFRAQQCAKRNSYYVHENTKHSWIPYEPDDDAQKCELICQSEDTGDVVF
MNQVVHDGTRCSYRDLYSVCARGECVPVGCDKEVGSMKADDKCGVCGGDNSHCRTVKGTL
GKASKQAGALKLVQIPAGARHIQIEELEKVPHHIAVKNQVTGSFILNPKGKETTSRTFTA
MGLEWEYAVEDAKESLKTSGPLPEAVTVLVLPPAESGPRSSLAYKYIIHEDLLPLIGSNN
VLLEETDTYEWALKSWAPCTKACGGGIQFTKYGCRRRRDHHMVQRHLCDHRKRPKPIRRR
CNQHPCAQPGWVTEEWGACSRSCGKLGVQTRGVQCLLPLTNGTHKAMPAKACPGERPEAR
RPCLRVPCPLQWRTGAWSQYLCGEGSRDHRVLCFLENSSVLGACTGAKPDTIQACSLPAC
GGNLQNSTVKADVRELVTPEGQWVPQSGPLDPINKISSTELCVRDRSIFCRTEELDRYCS
IPGFHRLCCESCTKKALSLDPGLASPPPFSTPGSPFSAPVAPPDAVEPSVGPTGTDHRQR
DQPTLLPGPLGTSAPVTRSYFAPQKPTPTAFRGTSPSAPWGWTGAPTPASENKGLLREDP
KHPGTSLPSTAPVT
Download sequence
Identical sequences W5P843
ENSOARP00000006598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]