SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5P9E3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5P9E3
Domain Number 1 Region: 14-123
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-22
Family Spermadhesin, CUB domain 0.00096
Further Details:      
 
Domain Number 2 Region: 198-300
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.07e-19
Family Platelet-derived growth factor-like 0.0064
Further Details:      
 
Weak hits

Sequence:  W5P9E3
Domain Number - Region: 153-207
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 0.0863
Family VanX-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5P9E3
Sequence length 307
Comment (tr|W5P9E3|W5P9E3_SHEEP) Platelet derived growth factor C {ECO:0000313|Ensembl:ENSOARP00000007051} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=PDGFC OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
GVQDPQHERIITVSTNGSIHSPRFPHTYPRNMDLVWRLVAVEENVWIQLTFDERFGLEDP
EDDICKYDFVEVEEPSDGTILGRWCGSGSVPGKQISKGNQIRIRFVSDEYFPSEPGFCIH
YNIVMPQLTETVSPSSLPASALPLDLLNNAVTAFSTLEDLIRYLEPDRWQLDLEDLYRPT
SLQLLGKNYMFGRKSRVVDLNLLKEEVRLYSCTPRNFSVSVREELKRTDTIFWPGCLLVK
RCGGNCACCLQTCSECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCV
CRGNPGG
Download sequence
Identical sequences W5P9E3
ENSOARP00000007051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]