SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PAL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PAL3
Domain Number 1 Region: 150-467
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.94e-125
Family Transglutaminase core 0.00000000348
Further Details:      
 
Domain Number 2 Region: 9-149
Classification Level Classification E-value
Superfamily E set domains 4.9e-43
Family Transglutaminase N-terminal domain 0.0000888
Further Details:      
 
Domain Number 3 Region: 501-612
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.06e-26
Family Transglutaminase, two C-terminal domains 0.00026
Further Details:      
 
Domain Number 4 Region: 615-710
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.38e-25
Family Transglutaminase, two C-terminal domains 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5PAL3
Sequence length 713
Comment (tr|W5PAL3|W5PAL3_SHEEP) Transglutaminase 6 {ECO:0000313|Ensembl:ENSOARP00000007473} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=TGM6 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
PISLCSPCPGLRVTEVDWQRLSNGTAHHTQEYPGPELVVRRGQRFTFTLELSRPLESEET
LIFTVETGPQASEALRTKAVFQTSELERGDTWMAVKEAQTENTTTFSLASPPNAIIGRYQ
LSARVSSRRKHSDRKLGEFVLLFNPWCPEDDVFLDSEEERQEYVLNDSGIIFRGVEKRIR
AQGWNFGQFEEDILNICLSILDRTPSYQDDPATDVSHRHDPIYITRAVSAMVNSNNDRGV
VQGQWRGKYGGGTSPLHWSGSVTILHKWFKGRFKPVKYGQCWVFAGVMCTVLRCLGIATR
VVSNFNSAHDTDRNLSVDKYVDSFGRTLGDLTEDSMWNFHVWNESWFARRDLGPSYNGWQ
VLDATPQEESEGVFRCGPASVTAIREGDVHLAHDGPFVFAEVNADYITWLWNEDESRERV
YSDTKKIGRCISTKAVGSDSRVDITSLYKYPEGSQKERQVYSKAVKKLFSVEASARRAWV
RRGGSRRLWRDDLLEPATKPSITGKFKVLEPPVLGHDLKLALCLTSLISRAQRVQVNLSG
ATILYTRRPVAEILHESHTVKLGPEEEKKIPIAISYSQYKEGLTEDKKILLAAMCLVTKG
EKLLVEKDITLEDFITIKVLGPAVVGVAVAVEVMVLNPLSERVEDCMLMVEGSGLLQGQL
SIDVPSLEPEEKASVQFKITPFKSGPRQLQVDFVSPHFPDIKGFVIIHVATAK
Download sequence
Identical sequences W5PAL3
ENSOARP00000007473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]