SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PBA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PBA6
Domain Number 1 Region: 705-760
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000051
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 2 Region: 762-810
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000116
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 3 Region: 649-705
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000183
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 4 Region: 596-646
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 5 Region: 849-902
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 6 Region: 538-584
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000837
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5PBA6
Sequence length 902
Comment (tr|W5PBA6|W5PBA6_SHEEP) Spondin 1 {ECO:0000313|Ensembl:ENSOARP00000007717} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=SPON1 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MISSLDPGNSASQNKHHRAANRQLRNKTALRWGSGQNQPSLLLLLLRRRPPFLALLGELR
SPPGLCQVSFPRGPLRAGVVWREPAARAQSWGPARMRLSPVLLRLSRGPALLALALPLAV
ALAFSDETLDKVPKSEGYCSRILRVQGTRREGYTEFSLRVEGDPDFYKPGTSHRVTLSAA
PPSYFRGFTLIALKENREGDKEEDHAGTFQIIDEEETQFMSNCPVAVTESTPRRRTRIQV
FWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQDSTFDGVTDKPILDCCACGTA
KYRLTFYGNWSEKTHPKDYPRRANHWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSP
VKMEEEIRQQSDEVLTVIKAKAQWPAWQPLNVRAAPSAEFSVDRTRHLMSFLTMMGPSPD
WNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQEKIRPLTSLDHP
QSPFYDPEGGSITQVARVVIERIARKGEQCNIVPDNVDDIVADLAPEEKDEDDTPETCIY
SNWSPWSACSSSTCDKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMS
EWITWSPCSISCGAGMRSRERYVKQFPEDGSVCTLPTEETEKCTVNEECSPSSCLTTEWG
EWDECSATCGMGMKKRHRMVKMSPADGSMCKAETSQAEKCMMPECHTIPCLLSLWSEWSD
CSVTCGKGMRTRQRMLKSLAELGDCNEELEQVEKCMLPECPIDCELTEWSQWSECNKSCG
KGHMIRTRMIQMEPQFGGAPCPETVQRKKCRIRKCLRNPSLQNLRWREARESRRSEQLRE
ESDGDQFPGCRMRPWTAWSECTKLCGGGIQERYMTVKKRFKSSQFTSCKDKKEIRACNVH
PC
Download sequence
Identical sequences W5PBA6
ENSOARP00000007717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]