SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PBY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PBY3
Domain Number 1 Region: 542-791,832-945
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 2.88e-130
Family Oxysterol-binding protein 0.0004
Further Details:      
 
Domain Number 2 Region: 9-222
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.12e-42
Family Ankyrin repeat 0.0002
Further Details:      
 
Domain Number 3 Region: 237-346
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000545
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5PBY3
Sequence length 953
Comment (tr|W5PBY3|W5PBY3_SHEEP) Oxysterol-binding protein {ECO:0000256|RuleBase:RU003845} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=OSBPL1A OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MSTDAEQQLLHHARNGNAEEVRQLLETMERNEVIADINCKGRSKSNLGWTPLHLACYFGH
RQVVQDLLKAGAEVNVLNDMGDTPLHRAAFTGRKELVMLLLEHNADTTVVNGNGQTAKEV
THDKEIRNMLEAVERTQQRKLEELLLAAAREGRTAELTALLNRPNPPDVNCSDQLGNTPL
HCAAYRAHKQCALKLLKSGADPNLKNKNDQKPLDLAQGAEMKHVLVGNKIIHKALKRYEG
PLWKSSRFFGWRLFWVVLEHGVLSWYRKQPDAVHNAYRQGCKHLTQAVCTVKSTDSCLFF
IKCFDDTVHSFRVPKNSLQQTREDWLEAIEEHSAYSTHYCSQDQVTDDEEDDAVSAVDLK
ESLEKAQICQQRLDRDISNFLKMIKECDMAQEMLPSFIQKVEVVAEASRETCVALSDCLH
LFTKQEGVRNFKLEQEQEKNKILSEALATLATEHHELEQSLVKGSPPLSIFSEDEFYDAL
SDSESEGSLSRLEAVTAHSFDEEAEAPSSRQHRMSEGKDCGGGDALSNGIKKHRTSLPSP
MFSRNDFSIWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLADPV
ERMQCVAAFAVSAVASQWERTGKPFNPLLGETYELVRILRDDLGFRLISEQVSHHPPISA
FHAEGLNNDFIFHGSIYPKLKFWGKSVEAEPKGTITLELLEHNEAYTWTNPTCCVHNIIV
GKLWIEQYGNVEITNHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCALYGKWTE
CLYSVDPATFDAYKKNDKKNTEEKKNSKQVSASEESDEMPMPDSESVFVIPGSVLLWRIA
PRPPNSAQMYNFTSFAMVLNEVDKEMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLE
EKQRAARKNRSKSEEDWKTRWFHQGPNPYSGAQDWLYSGSYWDRNYFNLPDIY
Download sequence
Identical sequences W5PBY3
ENSOARP00000007944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]