SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PC76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PC76
Domain Number 1 Region: 296-498
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.57e-55
Family Reprolysin-like 0.00034
Further Details:      
 
Domain Number 2 Region: 588-645
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 8.24e-17
Family TSP-1 type 1 repeat 0.00026
Further Details:      
 
Domain Number 3 Region: 1130-1180
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000235
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 992-1051
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 5 Region: 933-993
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000916
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 6 Region: 1058-1118
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000109
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Weak hits

Sequence:  W5PC76
Domain Number - Region: 879-933
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000471
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5PC76
Sequence length 1224
Comment (tr|W5PC76|W5PC76_SHEEP) ADAM metallopeptidase with thrombospondin type 1 motif 18 {ECO:0000313|Ensembl:ENSOARP00000008037} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=ADAMTS18 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
AALTRLLLAALPAAGNGPAAPSRAGSPFPLQALQLCCLCCASVAAALASDSRGGDGSGLN
HDYVFVTPVEVDSGGSYISHDILHNGRKKRSAQSASSSLHYRFSAFGQELHLELKPSAIL
SSHFIVQVLGKDGASETREPAVPRCFYQGFIRNDSSSSVAVSTCAGLSGLIRTHKNEFLI
SPLPQLLAQEHNYSSPAGHHPHVLYKRTAEEKVRRCQGYLRSGRNPAGHPPSHTPHTSWS
PEREQHHGRLQTQHFCGRRKKYAPKPPTEDTYLRFDEYGSSGRPRRSAGKSQKGLNVETL
VVADKKMVEKHGKANVTTYILTVMNMVSSLFKDGTIGSDINIVVVSLILLEQDPGGLLIN
HHADQSLNSFCQWQSALVGKNGKRHDHAILLTGFDICSWKNEPCDTLGFAPISGMCSKYR
SCTINEDTGLGLAFTIAHESGHNFGMVHDGEGNPCRKTEGSIMSPTLTGNNGVFSWSSCS
RQYLKKFLSTPQAGCLVDEPKQTGQYKYPDKLPGQIYDADTQCKWQFGAKAKLCSLGFVK
DICKSLWCHRVGHRCETKFMPAAEGTVCGLSMWCRQGQCVKLGELGPRPIHGQWSAWSKW
SECSRTCGGGVRYQERHCNNPKPQYGGKFCPGSSRVYQLCNINPCDKNSLDFRAQQCAEY
NSKPFRGWFYQWKPYMKVEEEDRCKLYCKAENFEFFFAMSSKVKDGTPCSPNKNDVCIDG
ICEPVGCDHELGSKAVSDACGVCKGDNSTCKFYKGLYLNQHKANEYYPVVTIPAGARSIE
VQELQISSSYLAVRSLSHKYYLTGAWSVDWPGEFAFAGTVFEYQRAFNRPECLSAPGPIN
ETLVFEILMQGKNPGIAWKYALPKVTNGTLPASERHSYAWSTVQTDCSVSCGGGYISVKA
VCLRDQNTHVNSSFCNARARPATEPKVCNAFSCPAYWKPGEWSACSRSCAGGQQSRKVQC
TQKKPFQEEEAVLHSLCPVSTPTQVQACNSHACPPEWSPGPWSQCSKTCGRGVRKREVTC
RRAAVAEAVPESACAGAPRPDSQEGCVLGRCPKNSRLQWLITSWSECSVSCGLGVRKREM
KCSEKAFQGKLITFPERRCRNIKRPNLDLEETCNRGPCPARPGYSLAAGWYSSPWQQCTV
TCGGGVQTRSVHCVQQGRPSSSCLLRQKPPVLRACNTNFCPAPAKREDPSCVDLFGWCHL
VPQHGVCNHKFYGKQCCKSCARKS
Download sequence
Identical sequences W5PC76
ENSOARP00000008037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]