SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PCX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PCX9
Domain Number 1 Region: 9-134
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.89e-17
Family Growth factor receptor domain 0.0011
Further Details:      
 
Domain Number 2 Region: 114-169
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5PCX9
Sequence length 241
Comment (tr|W5PCX9|W5PCX9_SHEEP) R-spondin 3 {ECO:0000313|Ensembl:ENSOARP00000008291} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=RSPO3 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
VHPNVSQGCQGGCATCSDYNGCLSCKPKLFFVLERIGMKQIGVCLSSCPSGYYGTRYPDI
NKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEASE
WSPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTSEARKCTVQRKKCPKGERG
RKGRERKRKKPSKEESKDAIPDNKGLEPSRETPEQRENKQQQKKRKVQDKQQKSVSVSTV
H
Download sequence
Identical sequences W5PCX9
ENSOARP00000008291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]