SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PDP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PDP2
Domain Number 1 Region: 154-226
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.03e-16
Family Complement control module/SCR domain 0.00022
Further Details:      
 
Domain Number 2 Region: 215-276
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000183
Family Complement control module/SCR domain 0.00012
Further Details:      
 
Domain Number 3 Region: 90-164
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000556
Family Complement control module/SCR domain 0.00015
Further Details:      
 
Domain Number 4 Region: 28-95
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000764
Family Complement control module/SCR domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5PDP2
Sequence length 547
Comment (tr|W5PDP2|W5PDP2_SHEEP) Uncharacterized protein {ECO:0000313|Ensembl:ENSOARP00000008556} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN= OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MGLPPLPRPAPGVRKALAHSSLSQSFGDCSLPPDVPNAQATLGGLTSFPEQRTVTYKCNK
GFVKVPGKADSVVCQNNKWSELAEFCNRSCDVPTRLLFASLKKSYSQQNYFPEGSTVEYE
CRQGYIRDPSLSGNITCLQNFVWSKPDKFCKKKSCPKPREIENGHVKITTDILLGATIYF
SCNTGYKLVGAASSFCAPMGNTVGWSAGFPECQKILCPEPPKVDHGMIQEKQNSYAYGQS
ATYKCMEGFTLHGEISIYCTVRDDQGEWSGPLPQCRETDVSPTVLKSTEVNVPGTKVLST
PQKPTTVNVSATETPSTPQKPTTVNVSAIETPPTPQKPTTKPTAVNVPGTETPPTPQKLI
TINSSATKPPLVSQTYTTVNVPATKVPSPPQKPTTANGSATTAWNSPISNTVSTAAQNPI
MPNASATTPTTQRFTSAKSLLTQNLKATQKSTSVHTTKGLRITQRLTSARVTAAKSTAVP
RTTLRLHATSAPKGRGSAPSVASTIASGKCGSLRVRRICHRFWIYNSWKRILSEYKMLCC
CRHETKN
Download sequence
Identical sequences W5PDP2
ENSOARP00000008556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]