SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PGM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PGM3
Domain Number 1 Region: 1079-1246
Classification Level Classification E-value
Superfamily C-type lectin-like 1.7e-43
Family C-type lectin domain 0.00000569
Further Details:      
 
Domain Number 2 Region: 168-284
Classification Level Classification E-value
Superfamily C-type lectin-like 4.05e-39
Family Link domain 0.0019
Further Details:      
 
Domain Number 3 Region: 1247-1307
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000114
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 4 Region: 1043-1084
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000101
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 5 Region: 61-175
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000118
Family V set domains (antibody variable domain-like) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5PGM3
Sequence length 1355
Comment (tr|W5PGM3|W5PGM3_SHEEP) Neurocan {ECO:0000313|Ensembl:ENSOARP00000009589} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=NCAN OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
RPPRDALELGARSRMGALPVWVSGLLTLQMLLFVAGEQVRPSSPPFPPQARSTPLHMQKV
GSRSVRAALAELVALPCLFSLRPRPGATREAPRIKWTKVRTASGQRQDLPILVAKDNVVR
VAKGWQGRVSLPAYPRHRANATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVF
HYRAALDRYSLTFAEAQEACRLNSATIAAPRHLQAAFEDGFDNCDAGWLSDRTVRYPITQ
SRPGCYGDRSSLPGVRNYGRRDPRELYDVYCFARELGGEVFYVGLARRLTLAGARWPRPK
GVRFANGHAPTSGWKVSCLEPCTGAPAGKGTRLATPPRQGHGPRDRTRGWPSPLVTGIPE
TTQRVRGAQRDRTHHPTSQHGDPETPSSGDEGEILSAEGPPAGELEPSLQEEEVVAPDVQ
EPLVSSGEEESLILAEKQESQATPSRAPGVPTLASSPALEAEEVWLSTVAPSHSSVEAGT
VVGTHTDTAPASTTPRKRERFKGLNGRHFQQQEPQQGLKGALEASIQPPTPEAAGNYVEP
PMTTGATDALGSGQSQSPWAVLTNEVEMPRAGSLGGRSPQEPWLWPPTVVPPIIPDPSRA
LGLELEEAKHFSMRPVTSELPWSPSETTPNPSSGPSPAPWEASPALISPDLPVAAMLRAP
KLWLLSQAPPTPLPTEALATALPSSASEIEASPQDPIHPEVYSLPSSSGLAGQDRGSTSL
SAATDTQAGASPSSPGTDFGNTRGASPTELSKAEHPGSSPQASVDGSVVADVIISETATE
PMGAGGVSESEPGVLNTAESPTSSLQASIVKTQGIWASLHREGLDPHSPSAPLGVPEVSL
MPKVTPRLGPWAATEGGVTVDPMDPTVTLGTSDAGGHWEPGSHMVEGAESPTLSPQMAVD
ASVVTPLTSLDLGDKVGVLAVFTVASSSSQPHPEPKGQLVTQGTLGALEPPQEGSRSGDP
ILPPWTPTAANKDEPISVSSGEPTVPWDSPSTLLPASLGPEEFELEVLMGSPGVESFWEE
AASGEEPALPGTPANGSAEEVPLDPCENNPCLHGGTCRANGTVYGCSCDQGFAGENCEID
IDDCISSPCENGGTCIDEVNAFICLCLPSYGGSLCEKDTEGCDHGWHKFLGHCYRYFAHR
RAWEDAERDCRRRAGHLTSIHSPEEHNFINSFGRENTWIGLNDRIVERDFQWTDNTGLQF
ENWRENQPDNFFAGGEDCVVMVAHESGRWNDVPCNYNLPYVCKKGTVLCGPPPAVENASP
IGARKAKYNVHATVRYQCDEGFAQHHVAVIRCRSNGKWDRPQIVCTKPRRSHRMRRHHHH
HQHHHQHRHHKSRKERRKHKKHPAEDWEKEEGNFC
Download sequence
Identical sequences W5PGM3
ENSOARP00000009589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]