SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PH81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PH81
Domain Number 1 Region: 572-635
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000236
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 2 Region: 500-546
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000109
Family TSP-1 type 1 repeat 0.00063
Further Details:      
 
Domain Number 3 Region: 26-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000589
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 4 Region: 627-683
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000973
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 5 Region: 78-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000368
Family LDL receptor-like module 0.0014
Further Details:      
 
Weak hits

Sequence:  W5PH81
Domain Number - Region: 452-490
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000655
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5PH81
Sequence length 844
Comment (tr|W5PH81|W5PH81_SHEEP) Complement C7 {ECO:0000313|Ensembl:ENSOARP00000009798} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=C7 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MKAITLFFLVGFIGEFQVFSSASSPVNCQWGSYAPWSECNGCTKTQTRRRSIAVYGQYGG
HSCVGSAFETQPCKPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCEEDGADEDRCE
DAESRPACDVVKPPPNIELTGRGYNVLTGQFRNQVLNTKSFGGQCRKVYSGDGRDFYRLS
GNILSYTFQVKINNDFNHEFYNSTWAYVKDTSTEHSSSSQGRILFFHSSSSSYGYSSNTN
ILVKKKSYQLLVLQNTVEVAQFINNNPEFLQLAESFWKELSYLPSLYDYSAYRRLIDQYG
THYLQSGSLGGEYKVFFHMDSEKVKKFDFHSEDKRKCASSHFQFLFTSSKQKCTTMEEAL
KSVSVENEGNLLRGVPSVRGGRPGFSAGLSYLELNNPAGNKRRYSQWAGSVTDLPEVIKQ
KLTPLYELVKEVPCASVKKLYLKWAIEEYLDEFDPCHCRPCQNGGMATVQGSQCQCYCKP
NTFGVACEQGVLLGDQAGGVDGGWNCWSSWGPCVQGKKTRSRECNNPSPRAGGKSCIGET
SETRQCEDEELEHLRLLEPHCFPLSLVPTKFCSSPPALKDGFVQDEGATFPVGKNIVYTC
NEGYSLVGDPVARCGEDLQWLVGKMHCQKIACVLPALMDGIQSHPHKPFYTIGEKVTISC
SGSRSLEGPSTFLCSSSLKWSPEVKNVQCVQKEAPLTPKVPKCQPWEKLQNSRCVCKMPY
ECGSSLHVCARDERSKRILPLTVCKMHVLQCQGRNYTVAGRESCILPASAEKACGVCPLW
EKCDAEGSECVCRAASECEEAGFSVCVEVNGREQTMTECEAGVLRCRGLSISVTGIRPCA
AEAA
Download sequence
Identical sequences W5PH81
ENSOARP00000009798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]