SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PHZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PHZ2
Domain Number 1 Region: 327-426,493-512,585-681
Classification Level Classification E-value
Superfamily RNI-like 2.3e-25
Family Cyclin A/CDK2-associated p19, Skp2 0.045
Further Details:      
 
Domain Number 2 Region: 201-293
Classification Level Classification E-value
Superfamily F-box domain 3.01e-19
Family F-box domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5PHZ2
Sequence length 692
Comment (tr|W5PHZ2|W5PHZ2_SHEEP) F-box and leucine rich repeat protein 5 {ECO:0000313|Ensembl:ENSOARP00000010060} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=FBXL5 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
PFPSRACTFLCPDVQDYHIVLLKGLHSRKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQ
IENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAF
TRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCSQKDTAELLRGLSLWNQAEE
RQKFFKYSVDEKSDKEAEVSEQSTGISHLPPEVMVSIFSYLNPQELCRCSQVSTKWSQLA
KTGSLWKHLYPVHWARGDWYSGPATELDTEPDEEWVKNRQDESRAFQEWDEDADIDESEE
SGEESIAISIAQMEKRLLHGLIHNVLPYVGTSVKTLVLAYSSAVSSKMVRQILELCPNLE
HLDLTQTDISDSAFDSWSWLGCCQSLRHLDLSGCEKITDVALEKISRALGILTTHESGLL
KTSTSKDTSTTWKNKDITMQSFKQSACLHDVTNKDIGEEVDNEHPWTKPISSDDFTSPYV
WMLDAEDLADIEDAVEWRHRNVESLCVMETASNFSCPSSACYSKDIVGLRTSVCWQQHCA
SPAFAYCGHSYCCTGTALRTMSALPESSALCRKAPRTRLLREKDLIYSGSEKSDQETGRV
LLFLSLSGCYQITDHGLRVLTLGGGLPYLEHLNLSGCLTVTGAGLQDLVSACPSLNDEYF
YYCDNINGPHADTASGCQNLQCGFRACCRSGE
Download sequence
Identical sequences W5PHZ2
ENSOARP00000010060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]