SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PI07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PI07
Domain Number 1 Region: 342-392
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000432
Family TSP-1 type 1 repeat 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5PI07
Sequence length 826
Comment (tr|W5PI07|W5PI07_SHEEP) Thrombospondin type 1 domain containing 1 {ECO:0000313|Ensembl:ENSOARP00000010075} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=THSD1 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MKQMLKDFSNLLLVVLCDYVLGEAEYLVLGEPGHVALSNSTVTVDFHGANGTLRNVSVLL
VEASSNQTLTTKYLLTNQSQGTLEFECFYFKEAGDYWFMMTREATNSSLPVPSRERSAFL
KVEWPVFHVDLSRTSKAAEGTFQVGLFTSQPLCPFPGDKPNILLEVTFTNSLPEARANQA
LPLEIRASKRVALAQGQWVEFDCPPVGPEAYITVTVVLKLLGRDSVIMSTGPIDLAQKFG
YKLVMEPELTCEAGVEVTVLPPPCIFVQGVITVFKEAPRLPGERTNRLAENSLALGERRT
VFNCTLFDMGRNKYCFDFGVSSRSQFSAKEKECMLIRRSIETWGLWQPWSQCSASCGDGV
RERRRVCLTSSPSRPGCPGMSSETSPCSLEDCAVAFQPSSPSPLQPQAPVKSNNVVTVTG
ISLCLFIIVATVLITLWRKLGRAPKCSTPARHNSLHGPGCRKNSDEENICELSEPRGSFS
DVGDGPAGSPGDPGIPLTYRRSVPAPPDDEASGSESFQANAQKIIPPLFSYRLAQQQLKE
MKKKGLTETTKVYHVSQSPLTDTAIDAAAAAAAAAASPGGPESPEEATAGKFRIKSPFLE
QPPAVGAGDRPPSRLDHPLSAASCXRTASFHEARQARPFRERSLSTLTPRPTPAHGPRAR
TWDQAGERGRPPSRGAALFPEKRDHGPGAAGASGPLSPLPKPHSLGPPPRKPDLGDRQAG
FVGAGERPEPPRARRGPSPSHRSVSRKQPSPPAPKDGYQRVSPLSPSQGRKDKCQSFPAH
PEFAFYDNTSFGLTEAEQRMLDLPGYFGSNEEDETTSTLSVEKLVI
Download sequence
Identical sequences W5PI07
ENSOARP00000010075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]