SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PIY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PIY7
Domain Number 1 Region: 50-119
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000124
Family Growth factor receptor domain 0.0049
Further Details:      
 
Domain Number 2 Region: 114-155
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000434
Family Fibronectin type I module 0.035
Further Details:      
 
Domain Number 3 Region: 208-252
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000157
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5PIY7
Sequence length 354
Comment (tr|W5PIY7|W5PIY7_SHEEP) WNT1 inducible signaling pathway protein 3 {ECO:0000313|Ensembl:ENSOARP00000010407} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=WISP3 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MRGPLLSTLLLASLSQFCYRAQGAGLSDTAGEGSPGEVAEGHHRKQFCHWPCQCPGRKPS
CPPGVSLVRDGCGCCKICARQPGDTCNEADLCDPHKGLYCDYSADRPRYETGVCAHLIAV
GCEFNGVHYQNGQAFQPSPLFSCLCVGGAIGCTPLFIPKLANRHCSGAKGGEKTDQSKCG
LGSSQKQLSTSYKTMPAYRTLPLIWKRKCLVQATKWTPCSRTCGMGISNRVTNENTNCEM
RKEKRLCYIQPCDSDISKTAKIPKGKTCQPTFQPVKAEKFVFSGCSSTQSYRPTFCGICL
DKRCCVPNKSKMITIQFDCPNEGSFKWKMLWITSCVCQRNCRDPGDIFSELKIL
Download sequence
Identical sequences W5PIY7
ENSOARP00000010407 XP_004011244.1.66739 XP_011993065.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]