SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PJ61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PJ61
Domain Number 1 Region: 174-394
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.14e-50
Family Reprolysin-like 0.0034
Further Details:      
 
Domain Number 2 Region: 488-538
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000301
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 3 Region: 945-1001
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000249
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 4 Region: 833-894
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 5 Region: 897-940
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000445
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 6 Region: 775-834
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000068
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5PJ61
Sequence length 1070
Comment (tr|W5PJ61|W5PJ61_SHEEP) ADAM metallopeptidase with thrombospondin type 1 motif 17 {ECO:0000313|Ensembl:ENSOARP00000010481} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=ADAMTS17 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
PPPGHRWPRRRRRPRAPPAAPRARLGERALLLHLPAFGRDLYLQLRRDLRFLSGGFEVEE
AGAGGRHGRSAELCFYSGSVLGHPGSLVSLSACGAAGGLVGLIQLGQEQVLIQPLNSSQG
QEHLVRRKWSLTPSPSPEAQIPGQRCKVLTEKKKPRRGQASQDGRQRRSAIRLTSEHTVE
TLVVADADMVQYHGAEAAQRFILTVMNMVYNMFQHQSLGIKVNIQVTKLVLLRQRPAKLS
IGHHGERSLESFCHWQNEEYGGARYLGNNQVPGGKDDTPPVDAAVFVTRTDFCVHKDEPC
DTVGIAYLGGVCSAKRKCVLAEDNGLNLAFTIAHELGHNLGMNHDDDHSSCAGRSHIMSG
EWVKGRSPSDLSWSSCSRDDLENFLKSKVSTCLLVTDPRSRHAVRLPHKLPGMHYSANEQ
CQILFGTNATFCRNMEQHLMCAGLWCLVEGDTSCKTKLDPPLDGTECGADKWCRAGECVS
KTPIPEHVDGDWSPWGAWSMCSRTCGTGARFRQRKCDNPPPGPGGTHCLGASVEHTVCEN
LPCPKGLPSFRDQQCQTHDRLSSKKKGLLTAVVVDDKPCELYCSPLGKESPLLVADRVLD
GTPCGPYETDLCVHGRCQKIGCDGIIGSAAKEDRCGVCSGDGKTCRVVKGDFSHARGTGY
IEAAIIPAGARRIRVVEDKPGHSFLALKDSSKRSINSDWKIELPGEFQIAGTTVRYVRRG
LWEKISAKGPTKMPLHLMVLLFHDQNYGIHYEYTIPVNYTTENQSEPEKPQDSLFIWTHS
GWEGCSVQCGGGERRSIVSCTRIVNKTTTLVNDSDCPQASRPEPQVRRCNLHPCQSRWVA
GPWSPCSATCEKGIQHREVTCVYQLQNGTHVATRPLYCPVPRPSPVQSCEGQDCLSIWEA
SEWSQCSSSCGKGTQKRTVTCTNSQGKCDASTRPRAEEPCEDYSGCYEWKTGSWSKCSST
CGRGLQSRVVQCMHRVTGRHGNECPALSKPAAYRQCHQEVCNDKINVNTITSPRLAALTY
KCTRDQWTVYCRVIREKNLCQDMRWYQRCCQTCRDFYANKMRQPPPPPSS
Download sequence
Identical sequences W5PJ61
ENSOARP00000010481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]