SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PL66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PL66
Domain Number 1 Region: 42-321
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.44e-109
Family Inorganic pyrophosphatase 0.0000000545
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5PL66
Sequence length 339
Comment (tr|W5PL66|W5PL66_SHEEP) Pyrophosphatase (inorganic) 2 {ECO:0000313|Ensembl:ENSOARP00000011189} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=PPA2 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
XALLPLLRTSWAWPVGAAAAAAARLPRGASAGPGPRRTMALYRTEERGQPHSPDYRLFFK
NVAGHYISPFHDIPLKVDSEEENGIPTKRARNDEYENVFNMVVEVPRWTNAKMEIATKEP
LNPIKQDVKDGKLRYVANIFPHKGYIWNYGALPQTWEDPHRKDKSTDCCGDNDPIDVCEI
GSKVLSRGEVVHVKILGVLALIDQGETDWKLIAINVNDPEASKFHDIEDVKKYKPGYLEA
TLNWFRFYKIPEGKPENQFAFNGEFKNKAFALEVIKSTHECWKALLMDKCDGGAINCTNV
QVCDSPFHCSEEEARSLVESLVWLPHKRSFSKENIFRFL
Download sequence
Identical sequences W5PL66
ENSOARP00000011189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]