SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PM14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PM14
Domain Number 1 Region: 72-199
Classification Level Classification E-value
Superfamily EF-hand 1.29e-25
Family Calmodulin-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5PM14
Sequence length 261
Comment (tr|W5PM14|W5PM14_SHEEP) Calneuron 1 {ECO:0000313|Ensembl:ENSOARP00000011488} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=CALN1 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MRLPEQPGEGKPENEEKGGRGAPGGGEEPPRTQAPDFPTWEKMPFHHVTAGLLYKGNYLN
RSLSAGSDSEQLANISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELA
IIMQRLDMDGDGQVDFDEFMTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQRITLEELKH
ILYHAFRDHLTMKDIENIIINEEESLNETSGNCQTEFEGVHSQKQNRQTCVRKSLICAFA
MAFIISVMLIAANQILRSGME
Download sequence
Identical sequences E1BDZ7 W5PM14
XP_011959826.1.66739 XP_011959827.1.66739 XP_011959829.1.66739 XP_011959830.1.66739 XP_011959831.1.66739 XP_011999153.1.54773 XP_011999154.1.54773 XP_011999156.1.54773 XP_011999157.1.54773 XP_011999158.1.54773 ENSOARP00000011488 ENSBTAP00000053698 9913.ENSBTAP00000053698 ENSBTAP00000053698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]