SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PM33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PM33
Domain Number 1 Region: 42-159
Classification Level Classification E-value
Superfamily C-type lectin-like 1.43e-30
Family C-type lectin domain 0.00000201
Further Details:      
 
Domain Number 2 Region: 200-265
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.14e-16
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 3 Region: 255-321
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000032
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 503-568
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000695
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 5 Region: 636-701
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 6 Region: 317-383
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 7 Region: 440-506
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 8 Region: 379-445
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 9 Region: 581-647
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000514
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 10 Region: 162-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000947
Family EGF-type module 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5PM33
Sequence length 769
Comment (tr|W5PM33|W5PM33_SHEEP) P-selectin {ECO:0000313|Ensembl:ENSOARP00000011508} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=SELP OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MASCPKAIWSWRFQRVVFRSVQLLCISILIFELMTQKEVSAWTYHYSDKPYSWNYSRAFC
QKYYTDLVAIQNKNEIAYLNETIPYYNSYYWIGIRKIDNKWTWVGTKKTLTEEAENWADN
EPNNKKNNQDCVEIYIKSPSAPGKWNDEPCGKRKRALCYRASCQDMSCSKQGECIETIGN
YTCSCYPGFYGPECEYVRECGEFDLPQNVHMNCSHPLGNFSFKSQCSFHCAEGYALNGPR
ELECLASGIWTNSPPQCVAVQCPALKSPEQGSMSCFHSAKAFQHQSSCSFSCEEGFTLVG
PEVVHCTALGVWTAPTPVCKAIACESLESPVHGSMDCSPSPRAFQYNTSCSFRCAEGFTL
RGADTVRCADSGEWTAPAPVCQALQCQDLPTSNKARVNCSHPFGDFRYQSTCSFTCDEGS
FLVGASVLQCLDTGNWDAPFPECQAVTCAPLPNPQNGEKTCVQPLGGSSYKSTCWFTCHE
GFSLSGPERLDCTPSGHWTGSPPTCEASKCPELSAPEQGSLDCPDTHGEFIVGSICHFSC
NEGLKLEGSNHVECTASGRWTAPPPTCKVDTVSAPAPGVRCPSLIAPNQGTMSCQHHLRN
FGLNTTCHFGCKAGFTLMGESALQCRPSRQWTAVAPTCRAVKCSKLPVTEPIVMNCSNPW
GNFSYGSTCSFHCPEGQLLNGSERTACQENGQWSTTMPTCQAGPLTIQEALTYIGGAAAG
TTGLVTSSILLALLRRRRRQKDDGKSPLNPQSHLGTYGVFTNAAFDPSP
Download sequence
Identical sequences W5PM33
ENSOARP00000011508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]