SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PQG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PQG9
Domain Number 1 Region: 377-456
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000249
Family F-box domain 0.0045
Further Details:      
 
Domain Number 2 Region: 471-645
Classification Level Classification E-value
Superfamily RNI-like 0.000000216
Family Cyclin A/CDK2-associated p19, Skp2 0.034
Further Details:      
 
Weak hits

Sequence:  W5PQG9
Domain Number - Region: 7-40
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0819
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5PQG9
Sequence length 694
Comment (tr|W5PQG9|W5PQG9_SHEEP) F-box protein 41 {ECO:0000313|Ensembl:ENSOARP00000012696} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=FBXO41 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MASLDLPYRCPRCGEHKRFRSLSSLRAHLEYSHTYETLYILSKTNSICDGAAAAFPLAPR
ARLKIRALEKLEVDRRLERARLGREKEELEERASELSRQVDVSVELLASLKQDLVHKEQE
LSRKQQEVVQIDQFLKETAAREASAKLRLQQFIEELLQRADRAERQLQPSGFTSGAGVGG
GGGGAGAGPSTRAPGRTREHHAGPAMPSTYAVSRHGSSPSTGASSRIPAASQSSGCYDSD
SLELPRPEEGAPEDSGPGGLGTRVQAAGGGWERGQPPRSSGLRRQAIQNWQRRPRRHSTE
GEEGDVSDVGSRTTESEAEGPSDVPRPGPAMAGPVSSCRLSARPEGGSGRGRRAERGSPS
RSNEVISPEILKMRAALFCIFTYLDTRTLLHAAEVCRDWRFVARHPAVWTRVLLENARVC
SKFLAMLAQWCTQAHSLTLQNLKPRQRGKKESKEEYARSTRGCLEAGLESLLKAAGGNLL
ILRISHCPNILTDRSLWLASCYCRALQAVTYRSATDPVGHEVIWALGAGCREIVSLQVAP
LHPCQQPMRFSNRCLQMIGRCWPHLRALGVGGAGCGVQGLASLARNCMRLQVLELDHVSE
ITQEVAAEVCREGLKGLEMLVLTATPVTPKALLHFNSICRNLKSIVVQIGIADYFKEPSS
PEAQKLFEDMITKLQALRRRPGFSKILHIKVEGC
Download sequence
Identical sequences W5PQG9
ENSOARP00000012696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]