SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PRA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PRA7
Domain Number 1 Region: 90-145
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000392
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 2 Region: 145-200
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000235
Family TSP-1 type 1 repeat 0.0005
Further Details:      
 
Domain Number 3 Region: 42-85
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000667
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 4 Region: 203-250
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.00099
Further Details:      
 
Weak hits

Sequence:  W5PRA7
Domain Number - Region: 627-891
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00156
Family Rhodopsin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5PRA7
Sequence length 1237
Comment (tr|W5PRA7|W5PRA7_SHEEP) Adhesion G protein-coupled receptor B3 {ECO:0000313|Ensembl:ENSOARP00000012985} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=ADGRB3 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
EFGMMGDHTIKSQRPRSVHEKRVPQEQADAAKFMAQTGESGVEEWSQWSTCSVTCGQGSQ
VRTRTCVSPYGTHCSGPLRESRVCNNTALCPVHGVWEEWSPWSLCSFTCGRGQRTRTRSC
TPPQYGGRPCEGPETHHKPCNIALCPVDGQWQEWSSWSQCSATCSNGTQQRSRLCTAAAH
GGSECRGPWAESRECYNPECTANGQWNQWGHWSGCSRSCDGGWERRMRTCQGAAMTGQPC
EGTGEEVRRCSEQRCPAPYEICPEDYLMSMVWKRTPAGDLAFNQCPMNATGTASRRCSLS
LHGVAFWEQPSFARCISNEYRHLQHSIKEHLAKGQRMLAGDGMSQVTKTLLDLTQRKNFY
AGDLLMSVEILRNVTDTFKRASYIPASDGVQNFFQIVSNLLDEDNKEKWEDAQQIYPGSI
ELMQVIEDFIHIVGMGMMDFQNSYLMTGNVVASIQKLPAASVLTDINFPMKGRKGMVDWA
RNSEDRVVIPKSIFTPVSSKELDESSVFVLGAVLYKNLDLILPTLRNYTVVNSKIIVVTI
RPEPKTTDSFLEIELAHLANGTLNPYCVLWDDSKTNDSLGTWSTQGCRTVLTDASHTKCL
CDRLSTFAILAQQPREIIMESSSTPSVTLIVGSGLSCLALVTLAVVYAALWRYIRSERSI
ILINFCLSIISSNILILVGQTQTHNKSICTTTTAFLHFFFLASFCWVLTEAWQSYMAVTG
KIRTRLIRKRFLCLGWGLPALVVATSVGFTRTKGYGTDHYCWLSLEGGLLYAFVGPAAAV
VLVNMVIGILVFNKLVSRDGILDKKLKHRAGASLWSSCVVLPLLALTWMSAVLAMTDKRS
ILFQILFAVFDSLQGFVIVMVHCILRREVQDAFRCRLRNCQDPINADSSSSFPNGHAQIM
TDFEKDVDIACRSVLHKDIGPCRAATITGTLSRISLNDDEEEKGTNTEALSYSTLPGNVI
SKVIIQQPTGLHMPMGMNELGNQCLKKENSELRRTVYLCTDDNLRGADMDIVHPQERMME
SDYIVMPRSSVNTQPSMKEESKMNIGMETLPHERLLHYKVNPEFNMNPPVMDQFNMNLEP
HLAPQEHMQNLPFEPRTAVKNFMASELDENAGLSRSETGSTISMSSLERRKSRYSDLDFE
KVMHTRKRHMELFQELNQKFQTLDRFRDIPNTSSLENPAPNKNPWDTFKNPSEYQHYTTI
NVLDTEAKDALELRPAEWEKCLSLPLDVQEGDFQTEV
Download sequence
Identical sequences W5PRA7
ENSOARP00000012985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]