SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PRE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PRE3
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-39
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000463
Further Details:      
 
Domain Number 2 Region: 242-326
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 6.41e-29
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000172
Further Details:      
 
Domain Number 3 Region: 392-452
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000000523
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5PRE3
Sequence length 464
Comment (tr|W5PRE3|W5PRE3_SHEEP) Wiskott-Aldrich syndrome {ECO:0000313|Ensembl:ENSOARP00000013022} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=WAS OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MSGGPSGGRPGGRGGQGVQQNIPSTLLQDHENQQLFEMLGRKCWTLATAVVQLYLALPPG
AEHWTKGHCGAVCFVKDNPKKSYFIRLYGLQAGRLLWEQELYSQLVYSAPTPFFHTFAGD
DCQAGLNFADEGEAQAFRNLVQEKIQKRNQRQSGDRRQLPPPPVPASEERRGGLPPLPPH
PGGDQGGPAASPVSLGLVTVDIQNPDITNSRYRSLPAPGPGPSDKKRSGKKKISKSDIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISDAQLTDAETSKFIYDFIENQGGM
EAVRKEMRRQEPLPPPPPPSRGGNQPPRPPTVGSNKGRSGPLPPVPSGGAPPPPTPRGPP
PPGRGGPPGDGPIPPPPPPSLGLVGGPAPGGGRGALLDQIRQGIQLNKTPGAPESSALQP
PPQSSEGLVGALMHVMQKRSKAIHSSDEGEDQAGDDDDDDEWDD
Download sequence
Identical sequences W5PRE3
ENSOARP00000013022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]