SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PSZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PSZ6
Domain Number 1 Region: 546-576,714-788
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000549
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5PSZ6
Sequence length 960
Comment (tr|W5PSZ6|W5PSZ6_SHEEP) Solute carrier family 26 member 8 {ECO:0000256|RuleBase:RU362052} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=SLC26A8 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MQPDRSFQSFASRYRQSSFTYDVKRDVYNEENFQQEHRKKTASSGNADIDISTVSHHVEC
RCSWYKFQRCLLTVFPFLEWMCFYRFKDWLLGDLLAGISVGLVQIPQVLMLGLLARHLIP
PLNVSYAAFCASVIYGIFGSCHQMSIGTFFLVSALTINVLRTEPFNSGHLLLGTFIQDDF
SNITFYENYNRSLSSVASVTLLTGIIQLSMGMLGFGFIVTYIPEAAISGYLAATALHVML
SQLTCIFGVMISYNSGPIAFFYNIINYCLGLPKANSTSILLFLTTIVALRINKCIRICFN
QYPIEFPMEVFLILGFAAFSNKVNMATENSLMLIEMIPYSFLFPVTPDMSNLTEVLAESF
SLALVSSFLLIFLGKKIASFHNYDVNSNQDLIAIGLCNVVSSFFRSYVFTGAVARTIIQD
KTGGRQQFASLVGAGLMLLLMMKMAHFFYKLPNAIVAGIILSNVLPYLEVVYTLPSLWRQ
NQYDCLIWMVTFMSAILLGLDIGLVVAVTFAFFIITVQSHRTKILLLGQIPNTNIYRSFQ
DYREVANIPGVKIFQCCNAITFVNVHYLKRKVLEEIEMVKMPLTDEEIYTLFSPNEEGAQ
RGKICRCYCNCDEPEPLPRVIYTERYEVQRGRESSFINLVRCSRFESMDTGQSISEDQVP
YITSSSSQRNPNYEEVEKVWLSDDPSRSMTITLPEASDTQVRATKLLPYSTSTVLPSVHT
IILDFSMVHLVDAQALVVLRQMFCAFQNANILVLIAGCHSFVVRSLEKNDFFNAGITKAQ
LFLTLHDAVLFALSRKLPESSELSVDESETVIQETFSETDKKEESRHKTSRSFIEAPRSK
SPAFSLLPDPEMEEESNLDLYSTIQMSKDHGLDLDLDLDREVEPESELEPESELDQETEL
EPDPEASHKPTRQKYWSLFRAIIPRSPTHTQARTQSVDRRHQNVKPYTSKADTSEDALEI
Download sequence
Identical sequences W5PSZ6
XP_004018826.1.66739 XP_011967335.1.54773 ENSOARP00000013576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]