SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PU98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PU98
Domain Number 1 Region: 87-400
Classification Level Classification E-value
Superfamily RNI-like 1e-46
Family Cyclin A/CDK2-associated p19, Skp2 0.0062
Further Details:      
 
Domain Number 2 Region: 24-75
Classification Level Classification E-value
Superfamily F-box domain 1.44e-17
Family F-box domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5PU98
Sequence length 409
Comment (tr|W5PU98|W5PU98_SHEEP) F-box and leucine rich repeat protein 7 {ECO:0000313|Ensembl:ENSOARP00000014029} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=FBXL7 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MSTQPAGISEWKGLPHPLIRLASRPQKEQASIERLPDHAMVQVFSFLPTNQLCRCARVCR
RWYNLAWDPRLWRTIRLTGETINVDRALKVLTRRLCQDTPNVCLMLETLSVSGCRRLTDR
GLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASI
KLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLMIY
CASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRVTDVGIRYVAKYCGKLRYLN
ARGCEGITDHGLEYLAKNCAKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESIT
GQGLQIVAANCFDLQMLNVQDCEVSVEALRFVKRHCKRCVIEHTNPAFF
Download sequence
Identical sequences W5PU98
ENSOARP00000014029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]