SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PVK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PVK7
Domain Number 1 Region: 220-443
Classification Level Classification E-value
Superfamily RNI-like 2.35e-27
Family Cyclin A/CDK2-associated p19, Skp2 0.0000000173
Further Details:      
 
Domain Number 2 Region: 142-208
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000017
Family F-box domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5PVK7
Sequence length 479
Comment (tr|W5PVK7|W5PVK7_SHEEP) Uncharacterized protein {ECO:0000313|Ensembl:ENSOARP00000014490} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN= OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
RRRPWANVQRRRALDHWPNPATSQFHCVPKRESGRRAPLQLMHAFKTPKPADAIRRKHLQ
EISDQSSNLTTNFTWGWGSSKTSEMLSGMGVSALEKEEVDSENISQELCSNLSHPQSPPR
KRLKSKVNDKDFVIVCRPKLNRENFPSVSWDFLPDELLLGIFSCLCLLELMKVSSVCKRW
YKLVFDEFLWQTVDLMGRNLYPDVVGWLLSQGVVAFHCRLCLPQSFMDQPLAEHFSPFRL
QHPDLSNSVINVSTLHDLLSHCSKLQNLLEGLQLSDPVVNNLAQNTNLLRRNLSGYSGFS
ESSLKTLLSSCSRLDELNLSWCYDFTEKHVQVAVAHVSETITQLNLSRYCRNLQRSDVST
LVGRCPNLFHLDLSDSVMLNNDCFPEFYQLKYLQHLSFIWCYDIIPETLLELGEIPTLET
FQVFGIMPDGTLYLLKEALPHLQINCSHFITIARPTIGNKKNQEIWGIKCWKVCRKPNC
Download sequence
Identical sequences W5PVK7
ENSOARP00000014490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]