SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PXV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PXV3
Domain Number 1 Region: 7-71
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000523
Family Fibronectin type I module 0.019
Further Details:      
 
Domain Number 2 Region: 103-147
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000667
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5PXV3
Sequence length 254
Comment (tr|W5PXV3|W5PXV3_SHEEP) Connective tissue growth factor {ECO:0000313|Ensembl:ENSOARP00000015287} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=CTGF OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
SAKDGAPCVFGGTVYRSGESFQSSCKYQCTCLDGSVGCVPLCSVDIRLPSPDCPFPRRVK
LPGKCCEEWVCDEPKEHTVVGPALAAYRPEDTFGPDPTMIRANCLVQTTEWSACSKTCGM
GISTRVTNDNAFCRLEKQSRLCMVRPCEADLEENIKKGKKCIRTPKISKPIKFELSGCTS
MKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKSMMFIKTCACHYNCPGDNDI
FESLYYRKMYGDMA
Download sequence
Identical sequences W5PXV3
ENSOARP00000015287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]