SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PXX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PXX3
Domain Number 1 Region: 581-660
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.83e-23
Family Complement control module/SCR domain 0.0056
Further Details:      
 
Domain Number 2 Region: 453-531
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.19e-18
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Domain Number 3 Region: 206-268
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000183
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 4 Region: 396-456
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000256
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 5 Region: 334-389
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000577
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 6 Region: 273-327
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000389
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 7 Region: 522-578
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000786
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 8 Region: 89-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000011
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 9 Region: 152-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000446
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 10 Region: 37-95
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000157
Family Complement control module/SCR domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5PXX3
Sequence length 661
Comment (tr|W5PXX3|W5PXX3_SHEEP) Coagulation factor XIII B chain {ECO:0000313|Ensembl:ENSOARP00000015307} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=F13B OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MKSKGLALIIILIISGELHAEEKLCGFPSVENGRIAQYYYTFESYYFPMSINQNLSFSCL
VGYTTATGKREARTTCTAAGWSPEPQCFKKCPKPDLKNGYIFDSKLSYKIQENMRYRCAS
GYKSIAGKDEEVVQCLADGWSSQPTCRKEHETCLAPELHHGNYSTTQKTFKVKDRVRYEC
ASGYHTASGKRTEEAECHPYGWALTPQCTKLKCSSLRVIENGYFHPVKQTYEEGDVVQFF
CHKNYYLSGSDLIQCYNFGWYPESPVCEGRRNRCPPPPLPLNSNLQTYSTTYRHGETVRI
ECGLNFARQGAEEIRCENGKWTEPPKCVEDKQRTTCEAPPSVGNGAANPPSEVYHSGDKV
AYVCERGYHLRGPGEITCNHGRWTLPPECVENTENCNPPPGVINGAIIGELLASYPTGSS
VEYRCNEYYLLRGAKISHCEQGRWSSPPVCLEPCTVNVVDMHRNNVEMKWNYEGKILHGD
LIDFVCKQGYELSPSTPPSELSVQCNRGEVKYPSCIRKESKRACASPPAIKNGVIKSSAL
NTYENGSSVEYICFEHHFLQGARESYCLGGVWTTPPSCLEPCTLSFDTMENNNLLLKWNF
DNRPYIFHGEYVEFLCKRNTYIAGFPVSASESRVQCDRGQLNYPRCVQSERMLSYQEPLR
T
Download sequence
Identical sequences W5PXX3
XP_004013974.1.66739 ENSOARP00000015307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]