SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5PZR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5PZR0
Domain Number 1 Region: 20-252
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.01e-69
Family BAR domain 0.00044
Further Details:      
 
Domain Number 2 Region: 244-276,307-364
Classification Level Classification E-value
Superfamily SH3-domain 3.66e-18
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5PZR0
Sequence length 365
Comment (tr|W5PZR0|W5PZR0_SHEEP) SH3 domain containing GRB2 like, endophilin B1 {ECO:0000313|Ensembl:ENSOARP00000015946} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=SH3GLB1 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIM
KQTEVLLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIK
CGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLK
KAKAAETRASSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQ
CYQYMLDLQKQLGSFPSSYHSNNNQTSVAPVPSASSNVIGSSALTSTSSLVIASPSNLTD
LKECSGSRRARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERGNQKGRVPITY
LELLN
Download sequence
Identical sequences W5PZR0
ENSOARP00000015946 XP_004002209.1.66739 XP_011990012.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]