SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5Q015 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5Q015
Domain Number 1 Region: 102-183
Classification Level Classification E-value
Superfamily F-box domain 1.96e-19
Family F-box domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5Q015
Sequence length 363
Comment (tr|W5Q015|W5Q015_SHEEP) Uncharacterized protein {ECO:0000313|Ensembl:ENSOARP00000016051} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=FBXO16 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MLFSPSSLPRCTKKDYIRISSYFMMAFAPPKNTNGPKMQTKMSTWTPLNHQLLNDRAFEE
RRALLGKWFDKWTDTQRRRILTSLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLS
LYIFSFLDPRSLCRCAQVSWHWKNLTELDQLWMLKCLRFNWYINFSPTPYEQGVWKKHYI
QMVKELHVTKPKTPPKDGFVIADVQPIRSSSPGGKLSPSSAFRSSSSLRKKNHPGEKELP
PWRSSDKHPTDIIRFNYLDNRDPIEHSWQGRRKRQEMTPAFNRQSRDKTNKSQERSKLRK
AQSLSSLNAEPRASLHVPAHLAWLPHQPLGLPATEAATKTLTQHLQRLSGLQSSPQAFQQ
QLM
Download sequence
Identical sequences W5Q015
ENSOARP00000016051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]