SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5Q0A0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5Q0A0
Domain Number 1 Region: 33-147
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000302
Family Growth factor receptor domain 0.0013
Further Details:      
 
Domain Number 2 Region: 145-197
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000222
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5Q0A0
Sequence length 208
Comment (tr|W5Q0A0|W5Q0A0_SHEEP) R-spondin 2 {ECO:0000313|Ensembl:ENSOARP00000016136} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=RSPO2 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
ISFSLAYFMILFLPARDFYPRCQGCRKFLWQRAGYVSNPICKGCLSCSKDNGCSRCQQKL
FFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYL
HRGRCFEECPDGFAPLDETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKK
PAKDTIPCPTIAESRRCKMAMRHCPGGE
Download sequence
Identical sequences W5Q0A0
ENSOARP00000016136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]