SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5Q1I9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5Q1I9
Domain Number 1 Region: 258-463
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.05e-54
Family Reprolysin-like 0.00055
Further Details:      
 
Domain Number 2 Region: 551-608
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000183
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 889-954
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000209
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 4 Region: 957-1000
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000157
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 5 Region: 1099-1142
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000562
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 6 Region: 1017-1077
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000353
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Weak hits

Sequence:  W5Q1I9
Domain Number - Region: 844-895
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0144
Family TSP-1 type 1 repeat 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5Q1I9
Sequence length 1186
Comment (tr|W5Q1I9|W5Q1I9_SHEEP) ADAM metallopeptidase with thrombospondin type 1 motif 16 {ECO:0000313|Ensembl:ENSOARP00000016577} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=ADAMTS16 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
XPSVRRPPGPAEWPGSGEEGDYELVSPYEVDHKGNYVSHEIAHPQRRKRALAQLGVDSLH
LRLKGFRHDFHLDLKASSKLVAPGFLIQTLGKQGTKSVQAFPPEDFCFYQGSLRSHKNSS
VALSTCKGLSGMIRTQEADYFLKPLPSHLAGSPNDSTGGRPPSHILYKRSTEPLAMGPHR
IAMMEKKWGLENHHLFHHEDQSPHGFSFRHPQKQHFCGRRKKYMPKPPEEDLFILPDEYK
SCVRQKRSLLKSHRNEELNVETLVVVDKKMMQNHGHENITTYVLTVLNMVSALFKDGTIG
GNINIAIVALILLEEEQPGLVISHHADHSLSSFCQWQSGLTGRDGARHDHAILLTGLDIC
SWKNEPCDTLGFAPISGMCSKYRSCTINEDTGLGLAFTIAHESGHNFGMVHDGEGNVCKK
SEGHIMSPTLAGRNGVFYWSPCSRQYLHRFLSTAQATCLADRPKPVKEYRYPEKLPGELY
DANTQCKWQFGEKAKLCMLDFKKDICKALWCHRIGRKCETKFMPAAEGTTCGHDMWCRGG
QCVKYGDEGPKPTHGHWSDWSPWSPCSRTCGGGVSHRDRLCTNPRPSHGGKFCVGSTRTL
KLCNSHTCAHNSVDFRAQQCAEFNGKRFRGWFYKWKPYTHVEDQDFCKLYCIAEGFDFFF
SLSNKVTDGTPCSEDSRNVCIDGICERVGCDNILGSDATEDACGVCQGNNSSCTTHKGLY
AKQHRANQYYQMVTIPSGARSIHIYETNVSTSYISVRNALKKYYLNGHWTVDWPGRYKFS
GTIFDYSRSYKEPESLASPGPTNETLIVELLFQGRNPGIAWEYSMPRSGVEKKPGAQPSY
TWATIRSECSVSCGGGQTTTRAGCYRDLRVPVNASFCSPDARPATGVVPCKVSACPPSWS
VGNWSACSRTCGGGTQSRAVQCTRRAHYRSERVRASLCPQPVPSSRQACQPQSCPPAWST
GPWAECSRTCGKGWRKRSVACKSTNPSARAQLLPDAVCTTEPKPRTHEGRPARGRPTRHV
SAWSQCSVTCERGTQKRFLKCAEKYVSGKYRELASRKCLHLPQPQLELQRACARFPCPKR
PAFAAAGPPRASSVLPEAKCTASCGGGVQTRSVQCLAGGRSAAGCSLLQKPAVSQACNTR
FCPIAEKKGASCGDRFHWCALVPQRGVCGHRFYGQQCCKACSTSSL
Download sequence
Identical sequences W5Q1I9
ENSOARP00000016577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]