SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5Q3B7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5Q3B7
Domain Number 1 Region: 494-815
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.96e-108
Family PDEase 0.000000000015
Further Details:      
 
Domain Number 2 Region: 105-299
Classification Level Classification E-value
Superfamily GAF domain-like 1.98e-44
Family GAF domain 0.0000744
Further Details:      
 
Domain Number 3 Region: 285-489
Classification Level Classification E-value
Superfamily GAF domain-like 2.4e-37
Family GAF domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5Q3B7
Sequence length 833
Comment (tr|W5Q3B7|W5Q3B7_SHEEP) Phosphodiesterase {ECO:0000256|RuleBase:RU363067} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=PDE5A OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MLPFGDKTREMVNAWFAERVHTIPVCKEGIKGHTESCSCPLQPSPRAESSVPGTPTRKIS
ASEFDRPLRPIVIKDSEGTVSFLSDSDKKEQMPLTSPRFDNDEGDQCSRLLELVKDISSH
LDVTALCHKIFLHIHGLISADRYSLFLVCEDSSNDKFLISRLFDVAEGSTLEEASNNCIR
LEWNKGIVGHVAALGEPLNIKDAYEDPRFNAEVDQITGYRTQSILCMPIKNHREEVVGVA
QAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFE
EQQSLEVILKKIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTRER
DANRINYMYAQYVKNTMEPLNIPDVSKDKRFPWTNENLGNINQQCIRSLLCTPIKNGKKN
KVIGVCQLVNKMEETTGKVKPFNRNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVT
LEVLSYHASAAEEETRELQSLAAAVVPSAQTLRITDFSFSDFELSDLETALCTIRMFTDL
NLVQSFQMRHEVLCKWILSVKKNYRKSVAYHNWRHAFNTAQCMFAALKAGKIQKRLTDLE
ILALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCHSIMEHHHFDQCLMILNSPGNQILS
GLSIEEYKTTLKIIKQAILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFLAMLMTA
CDLSAITKPWPIQQRIAELVATEFFDQGDRERKELNIEPTDLMNREKKNKIPSMQVGFID
AICLQLYEALTHVSEDCFPLLDGCRKNRQKWQALAEQQEKTLINGESSQTKRN
Download sequence
Identical sequences W5Q3B7
ENSOARP00000017205 XP_004009636.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]