SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5Q415 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5Q415
Domain Number 1 Region: 180-375
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.47e-59
Family Astacin 0.00007
Further Details:      
 
Domain Number 2 Region: 807-914
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-38
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 3 Region: 382-491
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-36
Family Spermadhesin, CUB domain 0.00045
Further Details:      
 
Domain Number 4 Region: 491-600
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-35
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 5 Region: 647-757
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-35
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 6 Region: 938-1031
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-27
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 7 Region: 758-800
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000599
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 8 Region: 603-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000119
Family EGF-type module 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5Q415
Sequence length 1042
Comment (tr|W5Q415|W5Q415_SHEEP) Metalloendopeptidase {ECO:0000256|RuleBase:RU361183} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=TLL1 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGGVFAGLAATGAVLCAELGVCAGL
DYEYTFGGYGEDEAETLDYKDPCKAAVFWGDIALDDEDLNIFQIDRTIDLTQNPFGKFGH
TTGGFGDHGMSKKRGALYQLIDRIRRIGSGLEQNNTVKEKLPLKFSGQNEKNRVPRAATS
RTERVWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFIERGDEESYIVFTYRPCG
CCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPG
QEYNFLKMEPGEVNSLGESYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTR
LSKGDIAQARKLYRCPACGETLQESNGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNF
TTMDLYKSSLCWYDYIEVRDGYWRKSPLLGRFCGDKLPEVLTSTESRMWIEFRSSSNWVG
KGFAAVYEAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKIAVSEDCYVGLIFQAFEIER
HDNCAYDYLEVRDGTNESSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANF
FKEEDECAKPDRGGCEQHCLNTLGSYQCACEPGYELGPDRRTCEAACGGLLTNLNGTITT
PGWPKEYPPNKHCIWQVVAPTQYRISMKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGK
YCGAEVPEVITSHFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTVGS
YLCQCRNGFVLHENKHDCKEAECEQKIHSPSGFITSPNWPDKYPSRKECTWEISATPGHR
VKLAFTEFEIEQHQECAYDHLEVYDGETDKSPVLGRLCGNKIPEPLVATGNNMFVRFVSD
ASVQRKGFQAAHSTECGGRLKVESKPRDLYSHAQFGDNNYPGQVDCEWLLVSERGSRLEL
SFQIFEVEEEADCGYDYVELFDGLDSTAVGLGRFCGSGPPEEIYSIGDTVLIHFHTDDTI
SKKGFHIRYKSIRYPDSPHTKK
Download sequence
Identical sequences W5Q415
ENSOARP00000017454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]