SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5Q4P3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5Q4P3
Domain Number 1 Region: 193-484
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.34e-74
Family WD40-repeat 0.0000000000293
Further Details:      
 
Domain Number 2 Region: 74-190
Classification Level Classification E-value
Superfamily F-box domain 2.09e-29
Family F-box domain 0.000000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5Q4P3
Sequence length 508
Comment (tr|W5Q4P3|W5Q4P3_SHEEP) Beta-transducin repeat containing E3 ubiquitin protein ligase {ECO:0000313|Ensembl:ENSOARP00000017683} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=BTRC OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MKTENCVVKTKLANGTSSMIVPKQRKLSASYEKEKELCVKYFEQWSESDQVEFVEHLISQ
MCHYQHGHINSYLKPMLQRDFITALPAKARGLDHIAENILSYLDARSLCAAELVCKEWYR
VTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFKNKPPDGNAPPNSFYRALYPKIIQ
DIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKSTLECKR
ILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMV
TCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCE
FVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNK
RIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTI
LIWDFLNDPAAQAEPPRSPSRTYTYISR
Download sequence
Identical sequences W5Q4P3
ENSOARP00000017683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]